Citrus Sinensis ID: 007413

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600----
MAKNSETSAMEIDDKKSINSDQIGPKFSINVLQLLKSAQMQHGLRHGDYTRYRRYCTARLRRLYKSLKFTHGRGKYTRKAITESTVTEVRFLHLVLYTAERAWSHAMEKRQLPDGPNARQRIYLIGRLRKAVKWATLFSNLCAIKADPRTSLEAEAYASYMKGNLLFEQDQNWETALKNFKSARAVYEELGKYGDVENQVLCRERVEELEPSIRYCLHKIGESNVKTSELLQIGEMEGPALDLFKSKLEAVMAEARSQQAASLTEFHWLGHRFPISNAKTRVAILKAQELEKDLHVKAADSLPAEKKLVIFDKIFTAYHEARGCIRSDLASAGNAENVKDDLFGLDKAVSAVLGQRTIERNQLLVSIVKGKLTKQRDDKTGKVTKPEELVRLYDLLLQNTADLSDLVSSGRERKPEEVKFAEECELKSLAFRAERCFYLARSYSLAGKRTEAYALYCRARSHAENALKDFQRMANSDQMMIEELKTLCKECRSNSCIEHAKGIMVEEKASENLSNKISTVSISGTGKKSFQVDKFLLEKLDVYESAVGDSNVKGAARIEAFPPAFQSIARNPIVLDLAYNFIDFPSLENRMKKDRKGFISRLWR
ccccccccccccccccccccccccccEEEEHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccHHHHHcccccccccccc
*************************KFSINVLQLLKSAQMQHGLRHGDYTRYRRYCTARLRRLYKSLKFTHGRGKYTRKAITESTVTEVRFLHLVLYTAERAWSHAM**********ARQRIYLIGRLRKAVKWATLFSNLCAIKADPRTSLEAEAYASYMKGNLLFEQDQNWETALKNFKSARAVYEELGKYGDVENQVLCRERVEELEPSIRYCLHKIGESNVKTSELLQIGEMEGPALDLFKSKLEAVM********ASLTEFHWLGHRFPISNAKTRVAILKAQELEKDLHVKAADSLPAEKKLVIFDKIFTAYHEARGCIRSDLASAGNAENVKDDLFGLDKAVSAVLGQRTIERNQLLVSIVKGKL***************ELVRLYDLLLQNTADLSDLVSSGRERKPEEVKFAEECELKSLAFRAERCFYLARSYSLAGKRTEAYALYCRARSHAENALKDF********MMIEELKTLCKECRSNSCIEHAKGIMVEEKA***********************DKFLLEKLDVYESAVGDSNVKGAARIEAFPPAFQSIARNPIVLDLAYNFIDFPSL**********FISRLWR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKNSETSAMEIDDKKSINSDQIGPKFSINVLQLLKSAQMQHGLRHGDYTRYRRYCTARLRRLYKSLKFTHGRGKYTRKAITESTVTEVRFLHLVLYTAERAWSHAMEKRQLPDGPNARQRIYLIGRLRKAVKWATLFSNLCAIKADPRTSLEAEAYASYMKGNLLFEQDQNWETALKNFKSARAVYEELGKYGDVENQVLCRERVEELEPSIRYCLHKIGESNVKTSELLQIGEMEGPALDLFKSKLEAVMAEARSQQAASLTEFHWLGHRFPISNAKTRVAILKAQELEKDLHVKAADSLPAEKKLVIFDKIFTAYHEARGCIRSDLASAGNAENVKDDLFGLDKAVSAVLGQRTIERNQLLVSIVKGKLTKQRDDKTGKVTKPEELVRLYDLLLQNTADLSDLVSSGRERKPEEVKFAEECELKSLAFRAERCFYLARSYSLAGKRTEAYALYCRARSHAENALKDFQRMANSDQMMIEELKTLCKECRSNSCIEHAKGIMVEEKASENLSNKISTVSISGTGKKSFQVDKFLLEKLDVYESAVGDSNVKGAARIEAFPPAFQSIARNPIVLDLAYNFIDFPSLENRMKKDRKGFISRLWR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 68 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP68 binds the 7S RNA, SRP72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.probableQ00004
Signal recognition particle 68 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. Srp68 binds the 7S RNA, Srp72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.probableQ9VSS2
Signal recognition particle 68 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP68 binds the 7S RNA, SRP72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.probableQ9UHB9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!