Citrus Sinensis ID: 007434

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600----
MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVKKSAVFPYRWVLVQFGAFIVLCGATHLINLWTFNMHSRTVAIVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTRELFLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECALWMPTRTGLELQLSYTLRQQNPVGYTVPIQLPVINQVFSSNHAVKISPNCPVARLRPLAGKYMPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMQQNIALDSARREAETAIRARNDFLAVMNHEMRTPMHAIIALSSLLQETELTPEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLQIGTFNLHAVFREVLNLIKPIASVKKLLVALNLAPDLPEYAVGDEKRLMQTLLNVVGNAVKFTKEGNISITGFVAKSESLRDSRAPEFFPVPIENHFYLRVQVKDSGSGISPQDIPNLFTKFAQNQAIALRNSSGSGLGLAICKRFVNLMEGHIWIESEGLGKGCTAIFIVKLGIPEHSNDSNLSFIPKMPC
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccEEEEEcccccccEEEEEEEEcccccccccccccccHHHHHccccccEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEECccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEECccccccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEcccccCEEEEEEEEEccccccccccccccccccc
***CNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVKKSAVFPYRWVLVQFGAFIVLCGATHLINLWTFNMHSRTVAIVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTRELFLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECALWMPTRTGLELQLSYTLRQQNPVGYTVPIQLPVINQVFSSNHAVKISPNCPVARLRPLAGKYMPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMQQNIALDSARREAETAIRARNDFLAVMNHEMRTPMHAIIALSSLLQETELTPEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLQIGTFNLHAVFREVLNLIKPIASVKKLLVALNLAPDLPEYAVGDEKRLMQTLLNVVGNAVKFTKEGNISITGFVAKS*******APEFFPVPIENHFYLRVQVKDSGSGISPQDIPNLFTKFAQNQAIALRNSSGSGLGLAICKRFVNLMEGHIWIESEGLGKGCTAIFIVKLGIP****************
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVKKSAVFPYRWVLVQFGAFIVLCGATHLINLWTFNMHSRTVAIVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTRELFLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECALWMPTRTGLELQLSYTLRQQNPVGYTVPIQLPVINQVFSSNHAVKISPNCPVARLRPLAGKYMPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMQQNIALDSARREAETAIRARNDFLAVMNHEMRTPMHAIIALSSLLQETELTPEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLQIGTFNLHAVFREVLNLIKPIASVKKLLVALNLAPDLPEYAVGDEKRLMQTLLNVVGNAVKFTKEGNISITGFVAKSESLRDSRAPEFFPVPIENHFYLRVQVKDSGSGISPQDIPNLFTKFAQNQAIALRNSSGSGLGLAICKRFVNLMEGHIWIESEGLGKGCTAIFIVKLGIPEHSNDSNLSFIPKMPC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ethylene receptor 2 May act early in the ethylene signal transduction pathway, possibly as an ethylene receptor, or as a regulator of the pathway.confidentQ9XH57
Ethylene receptor May act early in the ethylene signal transduction pathway, possibly as an ethylene receptor, or as a regulator of the pathway.confidentQ9M7M1
Ethylene receptor May act early in the ethylene signal transduction pathway, possibly as an ethylene receptor, or as a regulator of the pathway.confidentQ9ZWL6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.13.-Protein-histidine kinases.probable
2.7.13.3Histidine kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EW8, chain A
Confidence level:very confident
Coverage over the Query: 330-490,511-587
View the alignment between query and template
View the model in PyMOL
Template: 3E0Y, chain A
Confidence level:confident
Coverage over the Query: 156-253,268-317
View the alignment between query and template
View the model in PyMOL
Template: 3DGE, chain A
Confidence level:probable
Coverage over the Query: 346-478,497-577
View the alignment between query and template
View the model in PyMOL