Citrus Sinensis ID: 007450
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 603 | 2.2.26 [Sep-21-2011] | |||||||
| Q9C5S1 | 784 | Protein-tyrosine-phosphat | yes | no | 0.724 | 0.557 | 0.524 | 1e-148 | |
| Q9PW71 | 375 | Dual specificity protein | yes | no | 0.245 | 0.394 | 0.389 | 5e-22 | |
| Q91790 | 369 | Dual specificity protein | N/A | no | 0.228 | 0.373 | 0.388 | 1e-21 | |
| Q90W58 | 369 | Dual specificity protein | N/A | no | 0.228 | 0.373 | 0.381 | 1e-21 | |
| Q13115 | 394 | Dual specificity protein | no | no | 0.245 | 0.375 | 0.383 | 2e-21 | |
| Q62767 | 395 | Dual specificity protein | yes | no | 0.245 | 0.374 | 0.383 | 2e-21 | |
| Q8BFV3 | 398 | Dual specificity protein | yes | no | 0.245 | 0.371 | 0.383 | 2e-21 | |
| Q64623 | 367 | Dual specificity protein | no | no | 0.228 | 0.376 | 0.374 | 3e-21 | |
| P28563 | 367 | Dual specificity protein | no | no | 0.228 | 0.376 | 0.374 | 3e-21 | |
| P28562 | 367 | Dual specificity protein | no | no | 0.222 | 0.365 | 0.377 | 7e-21 |
| >sp|Q9C5S1|MKP1_ARATH Protein-tyrosine-phosphatase MKP1 OS=Arabidopsis thaliana GN=MKP1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 524 bits (1350), Expect = e-148, Method: Compositional matrix adjust.
Identities = 257/490 (52%), Positives = 334/490 (68%), Gaps = 53/490 (10%)
Query: 1 MVGEEDNNKHVDRLSGGSGNRRAYLRSVSWT------------DRSPNKPNPI------- 41
MVG ED + + G+++ + RS SW+ ++S N P I
Sbjct: 1 MVGREDAMGNDE---APPGSKKMFWRSASWSASRTASQVPEGDEQSLNIPCAISSGPSRR 57
Query: 42 -------PRPQPNSKARSLLPPLQPLSINRRPVEQWPRAGSDDLGVWPNPQTPRGS---- 90
PR NSKAR+ LPPLQPL+I+RR +++WP+AGSDD+G WP+P TP G+
Sbjct: 58 CPAAPLTPRSHHNSKARACLPPLQPLAISRRSLDEWPKAGSDDVGEWPHPPTPSGNKTGE 117
Query: 91 -VQLNPLESSSSELQPVKEFEFKKDKLAFFDKECSRIADHIYLGSDAVAKNRGILRQNGI 149
++L+ L S+ + K++K+AFFDKECS++ADHIY+G DAVAK++ IL+ NGI
Sbjct: 118 RLKLD-LSSTQQRVTDKSSGLAKREKIAFFDKECSKVADHIYVGGDAVAKDKSILKNNGI 176
Query: 150 THVLNCVGFVCPEYFKGDLVYKTLWLQDSPSEDITSILYDVFDYFEDVREQGGRVFVHCC 209
TH+LNCVGF+CPEYFK D Y++LWLQDSPSEDITSILYDVFDYFEDVREQ GR+FVHCC
Sbjct: 177 THILNCVGFICPEYFKSDFCYRSLWLQDSPSEDITSILYDVFDYFEDVREQSGRIFVHCC 236
Query: 210 QGVSRSTSLVIAYLMWREGQSFEDAFQYVKAARGVTNPNMGFACQLLLCQKRVHAMPASP 269
QGVSRSTSLVIAYLMWREGQSF+DAFQYVK+ARG+ +PNMGFACQLL CQKRVHA P SP
Sbjct: 237 QGVSRSTSLVIAYLMWREGQSFDDAFQYVKSARGIADPNMGFACQLLQCQKRVHAFPLSP 296
Query: 270 NSMLRIYRIAPHSSYDPLHLVPKLLNYPVAQGFDTRGAFIVLVPSAIYVWIGKNCSVMMS 329
S+LR+Y+++PHS YDPLHLVPKLLN P D+RGAFI+ +PSAIY+W+G+ C +M
Sbjct: 297 TSLLRMYKMSPHSPYDPLHLVPKLLNDPCPGSLDSRGAFIIQLPSAIYIWVGRQCETIME 356
Query: 330 NRAREAANQVIRYEKAQGQITSIKEGEEPLEFWDALVRGQFFADGCNKEEVKNEQVSFSG 389
A+ A Q+ RYEK + I ++EG+EP+ +WDA + G
Sbjct: 357 KDAKAAVCQIARYEKVEAPIMVVREGDEPVYYWDAFA----------------SILPMIG 400
Query: 390 SNKIATLMQDGAGEIDEYDLDFELFHKALDGGVVPPFSVSNAGSETCVPARESGWCRLRR 449
+ I +Q G ++D Y+LDFE+F KA++GG VP + SN ET +PARE+ W L+
Sbjct: 401 GSVIK--VQPGDRKVDAYNLDFEIFQKAIEGGFVPTLASSNNEHETHLPARENSWSSLKC 458
Query: 450 KFVNGLMREF 459
KF + + F
Sbjct: 459 KFASRFDKGF 468
|
Protein-tyrosine-phosphatase that act as negative regulator of MPK6 and MPK3 signaling by dephosphorylating and repressing MPK6 and MPK3. Modulates defense response by repressing salicylic acid (SA) production, camalexin biosynthesis and SNC1-mediated responses. Acts as a negative regulator of MPK6-mediated pathogen-associated molecular pattern (PAMP) responses, including MPK6 and MPK3 activation, accumulation of extracellular reactive oxygen species and inhibition of seedling growth. Involved in UV-B stress tolerance. May be involved in salt and genotoxic stress responses. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8 |
| >sp|Q9PW71|DUS4_CHICK Dual specificity protein phosphatase 4 OS=Gallus gallus GN=DUSP4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q91790|DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis GN=dusp1-a PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q90W58|DUS1B_XENLA Dual specificity protein phosphatase 1-B OS=Xenopus laevis GN=dusp1-b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q13115|DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens GN=DUSP4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q62767|DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus GN=Dusp4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8BFV3|DUS4_MOUSE Dual specificity protein phosphatase 4 OS=Mus musculus GN=Dusp4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q64623|DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus GN=Dusp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P28563|DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus GN=Dusp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P28562|DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens GN=DUSP1 PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 603 | ||||||
| 225424627 | 876 | PREDICTED: uncharacterized protein LOC10 | 0.834 | 0.574 | 0.729 | 0.0 | |
| 359480411 | 768 | PREDICTED: uncharacterized protein LOC10 | 0.842 | 0.661 | 0.663 | 0.0 | |
| 255578369 | 725 | dual specificity protein phosphatase, pu | 0.855 | 0.711 | 0.648 | 0.0 | |
| 449533276 | 823 | PREDICTED: protein-tyrosine-phosphatase | 0.900 | 0.659 | 0.629 | 0.0 | |
| 449434993 | 860 | PREDICTED: protein-tyrosine-phosphatase | 0.900 | 0.631 | 0.629 | 0.0 | |
| 74474913 | 874 | MAP kinase phosphatase 1 [Solanum tubero | 0.769 | 0.530 | 0.675 | 0.0 | |
| 210148266 | 536 | MAP kinase phosphatase [Datura metel] | 0.751 | 0.845 | 0.687 | 0.0 | |
| 356540231 | 738 | PREDICTED: uncharacterized protein LOC10 | 0.951 | 0.777 | 0.604 | 0.0 | |
| 356540229 | 664 | PREDICTED: uncharacterized protein LOC10 | 0.900 | 0.817 | 0.628 | 0.0 | |
| 357463227 | 721 | Dual specificity protein phosphatase [Me | 0.903 | 0.755 | 0.600 | 0.0 |
| >gi|225424627|ref|XP_002285484.1| PREDICTED: uncharacterized protein LOC100262951 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 759 bits (1961), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 380/521 (72%), Positives = 426/521 (81%), Gaps = 18/521 (3%)
Query: 1 MVGEEDNNKHVDRLSGGSGNRRAYLRSVSWTDRSPNKPNPIPRPQPNSKARSLLPPLQPL 60
M+ EED DRLSGG+G RRAYLRSVSWTDRSP KP +PRPQPNSK RS LPPLQPL
Sbjct: 1 MLREEDK----DRLSGGTGTRRAYLRSVSWTDRSPTKP--LPRPQPNSKVRSCLPPLQPL 54
Query: 61 SINRRPVEQWPRAGSDDLGVWPNPQTPRGSV-QLNPLESSSSELQPVKEFEFKKDKLAFF 119
SI+RR E+WPRAGSDDLGVWP+P TP G + + PLE+S+SE QP +EF+FK+DKLAFF
Sbjct: 55 SISRRNAEEWPRAGSDDLGVWPHPPTPGGRLGSIKPLENSNSE-QPQREFQFKRDKLAFF 113
Query: 120 DKECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEYFKGDLVYKTLWLQDSP 179
DKECSRIADHIYLGSDAVAKNR LRQNGITHVLNCVGFVCPEYFK DLVYKTLWLQDSP
Sbjct: 114 DKECSRIADHIYLGSDAVAKNRETLRQNGITHVLNCVGFVCPEYFKSDLVYKTLWLQDSP 173
Query: 180 SEDITSILYDVFDYFEDVREQGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVK 239
SEDITSILYDVFDYFEDVREQGGRV VHCCQGVSRS+SLVIAYLMWREGQSFE AFQYVK
Sbjct: 174 SEDITSILYDVFDYFEDVREQGGRVLVHCCQGVSRSSSLVIAYLMWREGQSFEGAFQYVK 233
Query: 240 AARGVTNPNMGFACQLLLCQKRVHAMPASPNSMLRIYRIAPHSSYDPLHLVPKLLNYPVA 299
AARGVTNPNMGFACQLL CQKRVHA+P SPNS+LR+YR+APHS YDPLHLVPK+L++P
Sbjct: 234 AARGVTNPNMGFACQLLQCQKRVHAVPVSPNSVLRMYRMAPHSPYDPLHLVPKMLSHPGT 293
Query: 300 QGFDTRGAFIVLVPSAIYVWIGKNCSVMMSNRAREAANQVIRYEKAQGQITSIKEGEEPL 359
G D+RGAFIV VPSAIYVWIGKNC+++MSN AR AA QVIRYE+AQG I SIKEGEE
Sbjct: 294 LGLDSRGAFIVHVPSAIYVWIGKNCNMVMSNNARAAAYQVIRYERAQGPIVSIKEGEETS 353
Query: 360 EFWDALVRGQFFADGCNKEEVKNEQVSFSGSNKIATLMQDGAGE--IDEYDLDFELFHKA 417
EFWDAL GQ ADG NK ++E S +K+ G GE +DEY+LDFE+FHKA
Sbjct: 354 EFWDALAGGQLLADGSNKVGSRDESSLSSEKDKVCP----GVGERKVDEYNLDFEIFHKA 409
Query: 418 LDGGVVPPFSVSNAGSETCVPARESGWCRLRRKFVNGLMREFVASKLNCATSAVNDESNM 477
L GGVVPPF +S GSETC+PARE+GW RLRRKF +G M+EFV +KLNC T + ++M
Sbjct: 410 LAGGVVPPFPLSGTGSETCLPARENGWGRLRRKFTSGFMKEFV-TKLNCDTIQSSHGADM 468
Query: 478 IIDTGKASEDAVSLAGFASPSSPPADVCGSPDSFDCFPNVS 518
IIDT + VS++ SPS+PP CGSPDS C PN S
Sbjct: 469 IIDTCNEVKQPVSISNPLSPSTPP---CGSPDSLPCSPNGS 506
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359480411|ref|XP_002267255.2| PREDICTED: uncharacterized protein LOC100254928 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255578369|ref|XP_002530051.1| dual specificity protein phosphatase, putative [Ricinus communis] gi|223530467|gb|EEF32351.1| dual specificity protein phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449533276|ref|XP_004173602.1| PREDICTED: protein-tyrosine-phosphatase MKP1-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449434993|ref|XP_004135280.1| PREDICTED: protein-tyrosine-phosphatase MKP1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|74474913|dbj|BAE44440.1| MAP kinase phosphatase 1 [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|210148266|gb|ABY58123.2| MAP kinase phosphatase [Datura metel] | Back alignment and taxonomy information |
|---|
| >gi|356540231|ref|XP_003538593.1| PREDICTED: uncharacterized protein LOC100775448 isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356540229|ref|XP_003538592.1| PREDICTED: uncharacterized protein LOC100775448 isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357463227|ref|XP_003601895.1| Dual specificity protein phosphatase [Medicago truncatula] gi|355490943|gb|AES72146.1| Dual specificity protein phosphatase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 603 | ||||||
| TAIR|locus:2100601 | 784 | MKP1 "mitogen-activated protei | 0.525 | 0.404 | 0.660 | 6.3e-140 | |
| UNIPROTKB|A8J529 | 174 | MKP1 "MAP kinase phosphatase 1 | 0.276 | 0.959 | 0.533 | 3.3e-47 | |
| DICTYBASE|DDB_G0288249 | 1543 | mkpA "gelsolin family protein" | 0.470 | 0.184 | 0.351 | 8.5e-45 | |
| UNIPROTKB|Q0DL92 | 466 | Os05g0115800 "Os05g0115800 pro | 0.381 | 0.493 | 0.428 | 1.4e-41 | |
| UNIPROTKB|Q23YA6 | 1194 | TTHERM_00899570 "Dual specific | 0.286 | 0.144 | 0.339 | 9.6e-32 | |
| ZFIN|ZDB-GENE-040426-709 | 367 | dusp4 "dual specificity phosph | 0.283 | 0.465 | 0.339 | 3.9e-23 | |
| DICTYBASE|DDB_G0271860 | 560 | DDB_G0271860 "putative protein | 0.296 | 0.319 | 0.351 | 1.1e-22 | |
| UNIPROTKB|F1NCC5 | 250 | DUSP4 "Dual-specificity protei | 0.245 | 0.592 | 0.389 | 4.5e-21 | |
| UNIPROTKB|K7GKU2 | 227 | DUSP1 "Uncharacterized protein | 0.228 | 0.607 | 0.374 | 7.5e-21 | |
| ZFIN|ZDB-GENE-040801-188 | 333 | dusp2 "dual specificity phosph | 0.255 | 0.462 | 0.375 | 7.5e-21 |
| TAIR|locus:2100601 MKP1 "mitogen-activated protein kinase phosphatase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1191 (424.3 bits), Expect = 6.3e-140, Sum P(3) = 6.3e-140
Identities = 212/321 (66%), Positives = 262/321 (81%)
Query: 48 SKARSLLPPLQPLSINRRPVEQWPRAGSDDLGVWPNPQTPRGSVQLNPLESS-SSELQPV 106
SKAR+ LPPLQPL+I+RR +++WP+AGSDD+G WP+P TP G+ L+ SS Q V
Sbjct: 71 SKARACLPPLQPLAISRRSLDEWPKAGSDDVGEWPHPPTPSGNKTGERLKLDLSSTQQRV 130
Query: 107 KEFEF---KKDKLAFFDKECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEY 163
+ K++K+AFFDKECS++ADHIY+G DAVAK++ IL+ NGITH+LNCVGF+CPEY
Sbjct: 131 TDKSSGLAKREKIAFFDKECSKVADHIYVGGDAVAKDKSILKNNGITHILNCVGFICPEY 190
Query: 164 FKGDLVYKTLWLQDSPSEDITSILYDVFDYFEDVREQGGRVFVHCCQGVSRSTSLVIAYL 223
FK D Y++LWLQDSPSEDITSILYDVFDYFEDVREQ GR+FVHCCQGVSRSTSLVIAYL
Sbjct: 191 FKSDFCYRSLWLQDSPSEDITSILYDVFDYFEDVREQSGRIFVHCCQGVSRSTSLVIAYL 250
Query: 224 MWREGQSFEDAFQYVKAARGVTNPNMGFACQLLLCQKRVHAMPASPNSMLRIYRIAPHSS 283
MWREGQSF+DAFQYVK+ARG+ +PNMGFACQLL CQKRVHA P SP S+LR+Y+++PHS
Sbjct: 251 MWREGQSFDDAFQYVKSARGIADPNMGFACQLLQCQKRVHAFPLSPTSLLRMYKMSPHSP 310
Query: 284 YDPLHLVPKLLNYPVAQGFDTRGAFIVLVPSAIYVWIGKNCSVMMSNRAREAANQVIRYE 343
YDPLHLVPKLLN P D+RGAFI+ +PSAIY+W+G+ C +M A+ A Q+ RYE
Sbjct: 311 YDPLHLVPKLLNDPCPGSLDSRGAFIIQLPSAIYIWVGRQCETIMEKDAKAAVCQIARYE 370
Query: 344 KAQGQITSIKEGEEPLEFWDA 364
K + I ++EG+EP+ +WDA
Sbjct: 371 KVEAPIMVVREGDEPVYYWDA 391
|
|
| UNIPROTKB|A8J529 MKP1 "MAP kinase phosphatase 1" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0288249 mkpA "gelsolin family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0DL92 Os05g0115800 "Os05g0115800 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q23YA6 TTHERM_00899570 "Dual specificity phosphatase, catalytic domain containing protein" [Tetrahymena thermophila SB210 (taxid:312017)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-709 dusp4 "dual specificity phosphatase 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0271860 DDB_G0271860 "putative protein tyrosine phosphatase, dual specificity" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NCC5 DUSP4 "Dual-specificity protein phosphatase 4" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GKU2 DUSP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-188 dusp2 "dual specificity phosphatase 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3.16 | 0.737 |
| 3rd Layer | 3.1.3 | 0.691 |
| 3rd Layer | 3.1.3.48 | 0.737 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00030744001 | SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (881 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 603 | |||
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 1e-55 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 3e-36 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 2e-31 | |
| smart00262 | 90 | smart00262, GEL, Gelsolin homology domain | 1e-12 | |
| cd11288 | 92 | cd11288, gelsolin_S5_like, Gelsolin sub-domain 5-l | 4e-11 | |
| cd11280 | 88 | cd11280, gelsolin_like, Tandemly repeated domains | 1e-06 | |
| cd11289 | 92 | cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-l | 8e-06 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 1e-05 | |
| cd11292 | 98 | cd11292, gelsolin_S3_like, Gelsolin sub-domain 3-l | 1e-04 | |
| pfam00626 | 76 | pfam00626, Gelsolin, Gelsolin repeat | 3e-04 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 6e-04 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 6e-04 |
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
Score = 183 bits (468), Expect = 1e-55
Identities = 59/139 (42%), Positives = 83/139 (59%), Gaps = 1/139 (0%)
Query: 122 ECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPE-YFKGDLVYKTLWLQDSPS 180
S I +YLGS A ++ +L++ GITHVLN V E F D Y + + D PS
Sbjct: 1 PLSEITPGLYLGSYPAASDKELLKKLGITHVLNVAKEVPNENLFLSDFNYLYVPILDLPS 60
Query: 181 EDITSILYDVFDYFEDVREQGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKA 240
+DI+ + D+ +D RE+GG+V VHC GVSRS +LVIAYLM G S +A+++VK+
Sbjct: 61 QDISKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLGLSLREAYEFVKS 120
Query: 241 ARGVTNPNMGFACQLLLCQ 259
R + +PN GF QL +
Sbjct: 121 RRPIISPNAGFMRQLKEYE 139
|
Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139 |
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214590 smart00262, GEL, Gelsolin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|200444 cd11288, gelsolin_S5_like, Gelsolin sub-domain 5-like domain found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200436 cd11280, gelsolin_like, Tandemly repeated domains found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200445 cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-like domain found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|200448 cd11292, gelsolin_S3_like, Gelsolin sub-domain 3-like domain found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201354 pfam00626, Gelsolin, Gelsolin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 603 | |||
| KOG1718 | 198 | consensus Dual specificity phosphatase [Defense me | 99.97 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.97 | |
| KOG1716 | 285 | consensus Dual specificity phosphatase [Defense me | 99.96 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 99.95 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.95 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.95 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.9 | |
| KOG0443 | 827 | consensus Actin regulatory proteins (gelsolin/vill | 99.9 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.81 | |
| KOG1719 | 183 | consensus Dual specificity phosphatase [Defense me | 99.77 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.77 | |
| KOG0443 | 827 | consensus Actin regulatory proteins (gelsolin/vill | 99.72 | |
| KOG1720 | 225 | consensus Protein tyrosine phosphatase CDC14 [Defe | 99.62 | |
| smart00262 | 90 | GEL Gelsolin homology domain. Gelsolin/severin/vil | 99.57 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.56 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.4 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.39 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.38 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.3 | |
| PF00626 | 76 | Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gel | 99.3 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.24 | |
| KOG0445 | 919 | consensus Actin regulatory protein supervillin (ge | 99.12 | |
| KOG2836 | 173 | consensus Protein tyrosine phosphatase IVA1 [Signa | 99.02 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 98.94 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 98.94 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 98.84 | |
| PLN02727 | 986 | NAD kinase | 98.7 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 98.67 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.57 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.49 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 98.35 | |
| KOG1572 | 249 | consensus Predicted protein tyrosine phosphatase [ | 98.27 | |
| KOG0445 | 919 | consensus Actin regulatory protein supervillin (ge | 98.24 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.23 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 98.18 | |
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 98.07 | |
| KOG2283 | 434 | consensus Clathrin coat dissociation kinase GAK/PT | 98.02 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 97.97 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 97.8 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 97.78 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 97.75 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 97.72 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 97.7 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 97.6 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 97.51 | |
| KOG2386 | 393 | consensus mRNA capping enzyme, guanylyltransferase | 97.37 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 97.36 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 96.83 | |
| KOG0790 | 600 | consensus Protein tyrosine phosphatase Corkscrew a | 96.79 | |
| KOG0789 | 415 | consensus Protein tyrosine phosphatase [Signal tra | 96.52 | |
| KOG0791 | 374 | consensus Protein tyrosine phosphatase, contains f | 95.76 | |
| KOG0793 | 1004 | consensus Protein tyrosine phosphatase [Signal tra | 95.27 | |
| KOG1984 | 1007 | consensus Vesicle coat complex COPII, subunit SFB3 | 95.13 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 94.87 | |
| COG5028 | 861 | Vesicle coat complex COPII, subunit SEC24/subunit | 91.85 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 91.04 | |
| PTZ00395 | 1560 | Sec24-related protein; Provisional | 91.02 | |
| KOG4471 | 717 | consensus Phosphatidylinositol 3-phosphate 3-phosp | 86.2 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 83.17 | |
| KOG1985 | 887 | consensus Vesicle coat complex COPII, subunit SEC2 | 82.51 |
| >KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
Probab=99.97 E-value=6.4e-31 Score=247.13 Aligned_cols=144 Identities=32% Similarity=0.513 Sum_probs=135.8
Q ss_pred ccceeccCCeEECChhhhCCHHHHHHCCCcEEEEcccCCCCCccCCCcEEEEEEccCCCCCchHHHHHHHHHHHHHHHhc
Q 007450 121 KECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEYFKGDLVYKTLWLQDSPSEDITSILYDVFDYFEDVREQ 200 (603)
Q Consensus 121 ~~~s~I~p~LyLGs~~~a~d~~~Lk~~GIt~ILNl~~e~~p~~~~~~i~yl~ipI~D~~~~dl~~~l~~av~fI~~a~~~ 200 (603)
..+++|++.|||++-..|.+...|+++|||+|||.+.+. |+..-.++.|..+|+.|.+...+.++|+.+.+.|+....+
T Consensus 15 ~~~SqIt~sLfl~~GvaA~~k~~l~~~~It~IiNat~E~-pn~~l~~~qy~kv~~~D~p~~~l~~hfD~vAD~I~~v~~~ 93 (198)
T KOG1718|consen 15 GGMSQITPSLFLSNGVAANDKLLLKKRKITCIINATTEV-PNTSLPDIQYMKVPLEDTPQARLYDHFDPVADKIHSVIMR 93 (198)
T ss_pred cchhhcCcceeEeccccccCHHHHHhcCceEEEEcccCC-CCccCCCceeEEEEcccCCcchhhhhhhHHHHHHHHHHhc
Confidence 458999999999987888899999999999999987655 6677788999999999999999999999999999999999
Q ss_pred CCeEEEEcCCCCchHHHHHHHHHHhhcCCCHHHHHHHHHHhcCccccCchhHHHHHHHhhhhccC
Q 007450 201 GGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKAARGVTNPNMGFACQLLLCQKRVHAM 265 (603)
Q Consensus 201 ggkVLVHC~aGiSRSaaVviAYLM~~~g~sl~eA~~~Vr~~RP~i~PN~~F~~QL~~~Ek~l~~~ 265 (603)
||++||||.+|+|||+++|+||||++.+|++.||+.+||++||+|.||-|||+||..||.++++.
T Consensus 94 gG~TLvHC~AGVSRSAsLClAYLmK~~~msLreAy~~vKa~RpiIRPN~GFw~QLi~YE~qL~g~ 158 (198)
T KOG1718|consen 94 GGKTLVHCVAGVSRSASLCLAYLMKYHCMSLREAYHWVKARRPIIRPNVGFWRQLIDYEQQLFGN 158 (198)
T ss_pred CCcEEEEEccccchhHHHHHHHHHHHccchHHHHHHHHHhhCceeCCCccHHHHHHHHHHHhcCC
Confidence 99999999999999999999999999999999999999999999999999999999999999764
|
|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0443 consensus Actin regulatory proteins (gelsolin/villin family) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0443 consensus Actin regulatory proteins (gelsolin/villin family) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00262 GEL Gelsolin homology domain | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF00626 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gelsolin is a cytoplasmic, calcium-regulated, actin-modulating protein that binds to the barbed ends of actin filaments, preventing monomer exchange (end-blocking or capping) [] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG0445 consensus Actin regulatory protein supervillin (gelsolin/villin family) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0445 consensus Actin regulatory protein supervillin (gelsolin/villin family) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00395 Sec24-related protein; Provisional | Back alignment and domain information |
|---|
| >KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1985 consensus Vesicle coat complex COPII, subunit SEC24/subunit SFB2 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 603 | ||||
| 3ezz_A | 144 | Crystal Structure Of Human Mkp-2 Length = 144 | 5e-20 | ||
| 3s4e_A | 144 | Crystal Structrue Of A Novel Mitogen-Activated Prot | 4e-18 | ||
| 2g6z_A | 211 | Crystal Structure Of Human Dusp5 Length = 211 | 1e-17 | ||
| 1m3g_A | 145 | Solution Structure Of The Catalytic Domain Of Mapk | 2e-17 | ||
| 2e0t_A | 151 | Crystal Structure Of Catalytic Domain Of Dual Speci | 3e-16 | ||
| 2nt2_A | 145 | Crystal Structure Of Slingshot Phosphatase 2 Length | 1e-15 | ||
| 2esb_A | 188 | Crystal Structure Of Human Dusp18 Length = 188 | 2e-15 | ||
| 2r0b_A | 154 | Crystal Structure Of Human Tyrosine Phosphatase-lik | 3e-15 | ||
| 2wgp_A | 190 | Crystal Structure Of Human Dual Specificity Phospha | 4e-15 | ||
| 4hrf_A | 160 | Atomic Structure Of Dusp26 Length = 160 | 4e-15 | ||
| 1wrm_A | 165 | Crystal Structure Of Jsp-1 Length = 165 | 1e-14 | ||
| 3lj8_A | 146 | Crystal Structure Of Mkp-4 Length = 146 | 3e-14 | ||
| 1yz4_A | 160 | Crystal Structure Of Dusp15 Length = 160 | 6e-14 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 2e-13 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 2e-13 | ||
| 2hcm_A | 164 | Crystal Structure Of Mouse Putative Dual Specificit | 3e-13 | ||
| 2hxp_A | 155 | Crystal Structure Of The Human Phosphatase (Dusp9) | 4e-13 | ||
| 2pq5_A | 205 | Crystal Structure Of Dual Specificity Protein Phosp | 6e-13 | ||
| 2y96_A | 219 | Structure Of Human Dual-Specificity Phosphatase 27 | 7e-13 | ||
| 1j4x_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase C124 | 2e-12 | ||
| 1mkp_A | 144 | Crystal Structure Of Pyst1 (Mkp3) Length = 144 | 2e-12 | ||
| 2gwo_A | 198 | Crystal Structure Of Tmdp Length = 198 | 2e-12 | ||
| 2oud_A | 177 | Crystal Structure Of The Catalytic Domain Of Human | 2e-11 | ||
| 1zzw_A | 149 | Crystal Structure Of Catalytic Domain Of Human Map | 2e-11 | ||
| 3emu_A | 161 | Crystal Structure Of A Leucine Rich Repeat And Phos | 2e-05 | ||
| 2j16_B | 182 | Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | 5e-05 | ||
| 1d0n_A | 729 | The Crystal Structure Of Calcium-Free Equine Plasma | 3e-04 | ||
| 2fgh_A | 731 | Atp Bound Gelsolin Length = 731 | 3e-04 | ||
| 3ffn_A | 782 | Crystal Structure Of Calcium-Free Human Gelsolin Le | 3e-04 | ||
| 1p8x_A | 344 | The Calcium-activated C-terminal Half Of Gelsolin L | 4e-04 | ||
| 1h1v_G | 331 | Gelsolin G4-G6ACTIN COMPLEX Length = 331 | 4e-04 | ||
| 2j17_A | 182 | Ptyr Bound Form Of Sdp-1 Length = 182 | 6e-04 | ||
| 1nph_A | 329 | Gelsolin Domains 4-6 In Active, Actin Free Conforma | 6e-04 | ||
| 2j16_A | 182 | Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | 7e-04 |
| >pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 | Back alignment and structure |
|
| >pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 | Back alignment and structure |
| >pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 | Back alignment and structure |
| >pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 | Back alignment and structure |
| >pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 | Back alignment and structure |
| >pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 | Back alignment and structure |
| >pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 | Back alignment and structure |
| >pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 | Back alignment and structure |
| >pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 | Back alignment and structure |
| >pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 | Back alignment and structure |
| >pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 | Back alignment and structure |
| >pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 | Back alignment and structure |
| >pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 | Back alignment and structure |
| >pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 | Back alignment and structure |
| >pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 | Back alignment and structure |
| >pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 | Back alignment and structure |
| >pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 | Back alignment and structure |
| >pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 | Back alignment and structure |
| >pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 | Back alignment and structure |
| >pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 | Back alignment and structure |
| >pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 | Back alignment and structure |
| >pdb|3EMU|A Chain A, Crystal Structure Of A Leucine Rich Repeat And Phosphatase Domain Containing Protein From Entamoeba Histolytica Length = 161 | Back alignment and structure |
| >pdb|2J16|B Chain B, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|1D0N|A Chain A, The Crystal Structure Of Calcium-Free Equine Plasma Gelsolin. Length = 729 | Back alignment and structure |
| >pdb|2FGH|A Chain A, Atp Bound Gelsolin Length = 731 | Back alignment and structure |
| >pdb|3FFN|A Chain A, Crystal Structure Of Calcium-Free Human Gelsolin Length = 782 | Back alignment and structure |
| >pdb|1P8X|A Chain A, The Calcium-activated C-terminal Half Of Gelsolin Length = 344 | Back alignment and structure |
| >pdb|1H1V|G Chain G, Gelsolin G4-G6ACTIN COMPLEX Length = 331 | Back alignment and structure |
| >pdb|2J17|A Chain A, Ptyr Bound Form Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|1NPH|A Chain A, Gelsolin Domains 4-6 In Active, Actin Free Conformation Identifies Sites Of Regulatory Calcium Ions Length = 329 | Back alignment and structure |
| >pdb|2J16|A Chain A, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
Score = 206 bits (526), Expect = 6e-64
Identities = 38/156 (24%), Positives = 70/156 (44%), Gaps = 1/156 (0%)
Query: 116 LAFFDKECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEYFKGDLVYKTLWL 175
L F ++I +I+LGS A N + N I+ +L VG P FK L +
Sbjct: 3 LTFPTLSPTQIIQYIHLGSFLNAHNVDYIHNNNISSILL-VGIEVPSLFKDQCDILRLDI 61
Query: 176 QDSPSEDITSILYDVFDYFEDVREQGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAF 235
+ + + + ++ V + GV+++ ++VIA+LM+ + SF +AF
Sbjct: 62 VSEEGHQLYDSIPNAIKFIIRSIQRKEGVLIISGTGVNKAPAIVIAFLMYYQRLSFINAF 121
Query: 236 QYVKAARGVTNPNMGFACQLLLCQKRVHAMPASPNS 271
V+ + + GF QL L +K++ M + +
Sbjct: 122 NKVQGLYPLIDIESGFILQLKLFEKKLEKMNSEGHH 157
|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 Length = 104 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A Length = 114 | Back alignment and structure |
|---|
| >1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Length = 347 | Back alignment and structure |
|---|
| >1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Length = 347 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} Length = 398 | Back alignment and structure |
|---|
| >3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} Length = 398 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Length = 344 | Back alignment and structure |
|---|
| >2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Length = 344 | Back alignment and structure |
|---|
| >3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Length = 371 | Back alignment and structure |
|---|
| >3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Length = 371 | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 603 | |||
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 100.0 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 100.0 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.98 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.97 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.97 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.97 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.97 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.97 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.97 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.96 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.96 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.96 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.96 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.96 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.96 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.96 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.95 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.95 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.95 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.95 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.94 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.92 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.92 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.92 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.91 | |
| 3fg7_A | 398 | Villin-1; actin binding protein, gelsolin, actin c | 99.91 | |
| 3fg6_A | 371 | Adseverin, scinderin; C-terminus of adseverin, act | 99.91 | |
| 2fh1_A | 344 | Gelsolin; calcium, contractIle protein; 1.55A {Hom | 99.91 | |
| 1j72_A | 347 | Macrophage capping protein; actin, human, CAP G, G | 99.89 | |
| 1d0n_A | 729 | Horse plasma gelsolin; mixed alpha-beta structure, | 99.88 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.86 | |
| 1d0n_A | 729 | Horse plasma gelsolin; mixed alpha-beta structure, | 99.86 | |
| 1kcq_A | 104 | Gelsolin, brevin, ADF, AGEL; alpha-beta structure, | 99.85 | |
| 1svq_A | 114 | Severin; actin-binding; NMR {Dictyostelium discoid | 99.83 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.8 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.8 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.78 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.76 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.75 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.74 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.74 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.72 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.56 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.55 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.48 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.33 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.28 | |
| 1j72_A | 347 | Macrophage capping protein; actin, human, CAP G, G | 99.11 | |
| 3fg7_A | 398 | Villin-1; actin binding protein, gelsolin, actin c | 98.87 | |
| 2fh1_A | 344 | Gelsolin; calcium, contractIle protein; 1.55A {Hom | 98.84 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 98.79 | |
| 3fg6_A | 371 | Adseverin, scinderin; C-terminus of adseverin, act | 98.79 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 98.68 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.53 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 98.53 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.52 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.48 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.47 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 98.47 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 98.46 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 98.45 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 98.44 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.44 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.39 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.39 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 98.38 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.36 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 98.36 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.36 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.35 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 98.33 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 98.31 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.3 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 98.29 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 98.27 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.27 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 98.26 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 98.26 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 98.21 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 98.16 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.12 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.11 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.07 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.06 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.06 | |
| 2vik_A | 126 | Villin 14T; actin-binding protein, capping protein | 98.02 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 97.97 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 97.96 | |
| 3cip_G | 128 | Gelsolin; actin, dictyostelium discoideum, actin-a | 97.92 | |
| 2ff3_A | 150 | Gelsolin; protein-protein complex, structural prot | 97.91 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 97.88 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 97.88 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 97.87 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 97.86 | |
| 1t44_G | 147 | Chimera of gelsolin domain 1 and C-terminal domain | 97.84 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 97.78 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 97.72 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.6 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.59 | |
| 3tu5_B | 297 | Gelsolin, protein cordon-BLeu, thymosin beta-4; un | 97.47 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 96.54 | |
| 3tu5_B | 297 | Gelsolin, protein cordon-BLeu, thymosin beta-4; un | 96.49 | |
| 3eh2_A | 766 | Protein transport protein SEC24C; copii-coat prote | 93.44 | |
| 3efo_B | 770 | SEC24 related gene family, member D; copii, coat p | 92.42 | |
| 3eh1_A | 751 | Protein transport protein SEC24B; copii coat prote | 91.92 | |
| 2nut_A | 769 | Protein transport protein SEC23A; human copii SEC2 | 88.04 | |
| 1m2o_A | 768 | SEC23, protein transport protein SEC23, SEC23P; zi | 84.68 |
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-33 Score=265.57 Aligned_cols=147 Identities=24% Similarity=0.315 Sum_probs=133.8
Q ss_pred cccccceeccCCeEECChhhhCCHHHHHHCCCcEEEEcccCCCCCccCCCcEEEEEEccCCCCCchHHHHHHHHHHHHHH
Q 007450 118 FFDKECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEYFKGDLVYKTLWLQDSPSEDITSILYDVFDYFEDV 197 (603)
Q Consensus 118 ~~~~~~s~I~p~LyLGs~~~a~d~~~Lk~~GIt~ILNl~~e~~p~~~~~~i~yl~ipI~D~~~~dl~~~l~~av~fI~~a 197 (603)
+++..+++|.|+||||+...+.+.+.|+++||++||||+.+. +..+..++.|+++|+.|.+..++.++|+++++||+++
T Consensus 5 ~p~~~~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~-~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~ 83 (161)
T 3emu_A 5 FPTLSPTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEV-PSLFKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRS 83 (161)
T ss_dssp CGGGSCEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC--------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHH
T ss_pred CCCCCceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCC-ccccCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHH
Confidence 345779999999999999999999999999999999998644 5667788999999999999999999999999999999
Q ss_pred HhcCCeEEEEcCCCCchHHHHHHHHHHhhcCCCHHHHHHHHHHhcCccccCchhHHHHHHHhhhhccC
Q 007450 198 REQGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKAARGVTNPNMGFACQLLLCQKRVHAM 265 (603)
Q Consensus 198 ~~~ggkVLVHC~aGiSRSaaVviAYLM~~~g~sl~eA~~~Vr~~RP~i~PN~~F~~QL~~~Ek~l~~~ 265 (603)
+++|++|||||.+|+|||+++++||||+.+||++++|+++||++||.+.||.+|+.||.+|++.+...
T Consensus 84 ~~~~~~VlVHC~~G~sRS~~vv~ayLm~~~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~ 151 (161)
T 3emu_A 84 IQRKEGVLIISGTGVNKAPAIVIAFLMYYQRLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKM 151 (161)
T ss_dssp HHTTCEEEEEESSSSSHHHHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHH
T ss_pred HhcCCeEEEEcCCCCcHHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcC
Confidence 99999999999999999999999999999999999999999999999999999999999999988654
|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} PDB: 2llf_A | Back alignment and structure |
|---|
| >3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A | Back alignment and structure |
|---|
| >1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* | Back alignment and structure |
|---|
| >1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 | Back alignment and structure |
|---|
| >1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A | Back alignment and structure |
|---|
| >3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} PDB: 2llf_A | Back alignment and structure |
|---|
| >2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* | Back alignment and structure |
|---|
| >2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3tu5_B Gelsolin, protein cordon-BLeu, thymosin beta-4; unusual hairpin conformation in the D-loop, structural prote binding protein complex; HET: ATP; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >3tu5_B Gelsolin, protein cordon-BLeu, thymosin beta-4; unusual hairpin conformation in the D-loop, structural prote binding protein complex; HET: ATP; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B | Back alignment and structure |
|---|
| >3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B | Back alignment and structure |
|---|
| >2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A | Back alignment and structure |
|---|
| >1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 603 | ||||
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 2e-36 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 5e-34 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 9e-34 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 1e-15 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 1e-15 | |
| d2fh1a2 | 96 | d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapien | 2e-13 | |
| d1j72a2 | 116 | d.109.1.1 (A:125-240) Macrophage capping protein C | 7e-13 | |
| d1svya_ | 102 | d.109.1.1 (A:) Severin, domain 2 {Dictyostelium di | 2e-12 | |
| d1kcqa_ | 104 | d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [Tax | 5e-11 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 6e-11 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 1e-09 | |
| d2fh1a3 | 113 | d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapien | 1e-08 | |
| d1d0na3 | 121 | d.109.1.1 (A:263-383) Gelsolin {Horse (Equus cabal | 6e-08 | |
| d1j72a3 | 107 | d.109.1.1 (A:241-347) Macrophage capping protein C | 2e-07 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 3e-07 | |
| d1xria_ | 151 | c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal | 7e-06 |
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pac-1 [TaxId: 9606]
Score = 130 bits (328), Expect = 2e-36
Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 1/139 (0%)
Query: 124 SRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEYFKGDLVYKTLWLQDSPSEDI 183
I +++LGS + + + L+ GIT VLN CP +F+G YK++ ++D+ +I
Sbjct: 5 VEILPYLFLGSCSHSSDLQGLQACGITAVLNVSAS-CPNHFEGLFRYKSIPVEDNQMVEI 63
Query: 184 TSILYDVFDYFEDVREQGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKAARG 243
++ + + + V+ GGRV VH G+SRS ++ +AYLM ++AF +VK RG
Sbjct: 64 SAWFQEAIGFIDWVKNSGGRVLVHSQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRG 123
Query: 244 VTNPNMGFACQLLLCQKRV 262
V +PN F QLL + +V
Sbjct: 124 VISPNFSFMGQLLQFETQV 142
|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} Length = 102 | Back information, alignment and structure |
|---|
| >d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} Length = 121 | Back information, alignment and structure |
|---|
| >d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 603 | |||
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.98 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.98 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.97 | |
| d2fh1a2 | 96 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1kcqa_ | 104 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1j72a2 | 116 | Macrophage capping protein Cap G {Human (Homo sapi | 99.81 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.81 | |
| d1svya_ | 102 | Severin, domain 2 {Dictyostelium discoideum [TaxId | 99.8 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.79 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.73 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.7 | |
| d2fh1a3 | 113 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.56 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.55 | |
| d1d0na3 | 121 | Gelsolin {Horse (Equus caballus) [TaxId: 9796]} | 99.5 | |
| d1j72a3 | 107 | Macrophage capping protein Cap G {Human (Homo sapi | 99.47 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 98.49 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.26 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 98.23 | |
| d2fh1a1 | 121 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 98.06 | |
| d1j72a1 | 114 | Macrophage capping protein Cap G {Human (Homo sapi | 98.01 | |
| d2vika_ | 126 | Villin, domain 1 (res. 1-126) {Chicken (Gallus gal | 98.0 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 97.95 | |
| d3cipg1 | 124 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 97.9 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 97.88 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 97.86 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 97.86 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 97.81 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 97.79 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 97.78 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.74 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 97.74 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 97.68 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 97.65 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.64 | |
| d2fh1a3 | 113 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 97.05 | |
| d1pd0a4 | 173 | Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.8 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 94.58 | |
| d1j72a3 | 107 | Macrophage capping protein Cap G {Human (Homo sapi | 93.54 | |
| d1d0na3 | 121 | Gelsolin {Horse (Equus caballus) [TaxId: 9796]} | 89.54 | |
| d1svya_ | 102 | Severin, domain 2 {Dictyostelium discoideum [TaxId | 83.03 |
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]
Probab=99.98 E-value=1.4e-32 Score=252.82 Aligned_cols=140 Identities=27% Similarity=0.441 Sum_probs=129.8
Q ss_pred ceeccCCeEECChhhhCCHHHHHHCCCcEEEEcccCCCCC-ccCCCcEEEEEEccCCCCCchHHHHHHHHHHHHHHHhcC
Q 007450 123 CSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPE-YFKGDLVYKTLWLQDSPSEDITSILYDVFDYFEDVREQG 201 (603)
Q Consensus 123 ~s~I~p~LyLGs~~~a~d~~~Lk~~GIt~ILNl~~e~~p~-~~~~~i~yl~ipI~D~~~~dl~~~l~~av~fI~~a~~~g 201 (603)
++||.|+||||+..++.+.+.|+++||++||||+.+.... ....++.|+++++.|.+.+++.++|+.+++||++++++|
T Consensus 4 P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~~ 83 (144)
T d1mkpa_ 4 PVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKN 83 (144)
T ss_dssp CEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSCCCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHTT
T ss_pred CCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccCCccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhcc
Confidence 5899999999999999999999999999999997654222 234679999999999999999999999999999999999
Q ss_pred CeEEEEcCCCCchHHHHHHHHHHhhcCCCHHHHHHHHHHhcCccccCchhHHHHHHHhhhh
Q 007450 202 GRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKAARGVTNPNMGFACQLLLCQKRV 262 (603)
Q Consensus 202 gkVLVHC~aGiSRSaaVviAYLM~~~g~sl~eA~~~Vr~~RP~i~PN~~F~~QL~~~Ek~l 262 (603)
++|||||.+|+|||+++++||||+++|+++++|+++||++||.+.||.+|+.||.+||+.+
T Consensus 84 ~~VlVHC~~G~~RS~~vv~aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L 144 (144)
T d1mkpa_ 84 CGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL 144 (144)
T ss_dssp CEEEEECSSCSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHTC
T ss_pred ceEEEEecccccchHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhhC
Confidence 9999999999999999999999999999999999999999999999999999999999864
|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|