Citrus Sinensis ID: 007454

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600---
MQSPCLREVSQACLCTHGGCCPSPFFSLSPDPLHKVSKSRNTSADCRRDFAAVTASSIFPDTQFTNHESLPSLQQSLTEFTKAYPQYFDTYQIDQIRAKEYYQLSLSNHTCLDYFGIGLFSYNQLHKQESSPSHLRPSLPSQNLDIPFFSVSYKTGNLKTQLLHGGQESGLESAMKKRIMDFLNISENDYVYDYESEAVEAMIRTSEKRGARVMSAEFSWPRLRINSEKLRKMVVSKGKKKKQRGLFVFPLHSRMTGARYPYLWMRIAQENDWHILIDACALGPKDMDSFGLSLVRPDFLICSFYQIFGENPSGFGCLFVKKSTVPILVDNTSSGMVSLLPAKKQLWLTDEFSSCETEPEQTSKSKQEKVAATNTFSGPMSIEMRQSGKLEQGEISEVRRAEADSIQQKNANTNGGGGSEIECRGLDQVDSLGLTMISRRGRCLINWLVNALMKLQHPNTEGNALVKIYGPKIRFDRGPALAFNVFDWKREKIEPVLVQKLADRENISLSYGSLHHIWFSDKYQKEKDNVLEKTDREAKSKSDNNRKDKANLGITVVTASLGYLANFEDVYRLWAFVAQFLDADFVEKARWRYTALDQKTIEV
cccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccEEEEccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccCEEEccccHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHcccccccccEEEEEcccccccccccHHHHHHHHHccEEEEEEccccccccccccccccccccEEEEEEcccccccccccEEEEECcccccccccccccccEEEcccccccccccccccccccccccccHHHHHHHccccccccccHHHHHcccccccccHHHHHccHHHHHHcccccccccccEEEEccHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccEEEEEEEccccccccHHHHHHHHHHccEEEcccccccHHHHHHHHHccHHHHHHHHHcccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccccc
**********QACLCTHGGCCPSPFF*********************************PDT*F**********QSLTEFTKAYPQYFDTYQIDQIRAKEYYQLSLSNHTCLDYFGIGLFSYNQLHKQESSPS********QNLDIPFFSVSYKTGNLKTQLLHGGQESGLESAMKKRIMDFLNISENDYVYDYESEAVEAMIRTSEKRGARVMSAEFSWPRLRINSEKLRKMVVSKGKKKKQRGLFVFPLHSRMTGARYPYLWMRIAQENDWHILIDACALGPKDMDSFGLSLVRPDFLICSFYQIFGENPSGFGCLFVKKSTVPILVDNTSSGMVSLLPAKKQLWLTDE********************ATNTFSGPMSIEMRQSGKLEQGEISEVRRAEADSIQQKNANTNGGGGSEIECRGLDQVDSLGLTMISRRGRCLINWLVNALMKLQHPNTEGNALVKIYGPKIRFDRGPALAFNVFDWKREKIEPVLVQKLADRENISLSYGSLHHIWFSDKYQKEKDNVLE**DRE**SKSDNNRKDKANLGITVVTASLGYLANFEDVYRLWAFVAQFLDADFVEKARWRYTALDQ**I**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSPCLREVSQACLCTHGGCCPSPFFSLSPDPLHKVSKSRNTSADCRRDFAAVTASSIFPDTQFTNHESLPSLQQSLTEFTKAYPQYFDTYQIDQIRAKEYYQLSLSNHTCLDYFGIGLFSYNQLHKQESSPSHLRPSLPSQNLDIPFFSVSYKTGNLKTQLLHGGQESGLESAMKKRIMDFLNISENDYVYDYESEAVEAMIRTSEKRGARVMSAEFSWPRLRINSEKLRKMVVSKGKKKKQRGLFVFPLHSRMTGARYPYLWMRIAQENDWHILIDACALGPKDMDSFGLSLVRPDFLICSFYQIFGENPSGFGCLFVKKSTVPILVDNTSSGMVSLLPAKKQLWLTDEFSSCETEPEQTSKSKQEKVAATNTFSGPMSIEMRQSGKLEQGEISEVRRAEADSIQQKNANTNGGGGSEIECRGLDQVDSLGLTMISRRGRCLINWLVNALMKLQHPNTEGNALVKIYGPKIRFDRGPALAFNVFDWKREKIEPVLVQKLADRENISLSYGSLHHIWFSDKYQKEKDNVLEKTDREAKSKSDNNRKDKANLGITVVTASLGYLANFEDVYRLWAFVAQFLDADFVEKARWRYTALDQKTIEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KMJ, chain A
Confidence level:confident
Coverage over the Query: 92-134,154-351,363-383,424-520,532-534,551-582
View the alignment between query and template
View the model in PyMOL
Template: 1QZ9, chain A
Confidence level:confident
Coverage over the Query: 76-134,154-351,363-383,424-511,552-592
View the alignment between query and template
View the model in PyMOL
Template: 2Z67, chain A
Confidence level:confident
Coverage over the Query: 84-335,370-383,424-518,530-538,551-580
View the alignment between query and template
View the model in PyMOL
Template: 2C81, chain A
Confidence level:confident
Coverage over the Query: 170-398,423-583
View the alignment between query and template
View the model in PyMOL