Citrus Sinensis ID: 007537
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 599 | ||||||
| 297744835 | 730 | unnamed protein product [Vitis vinifera] | 0.958 | 0.786 | 0.747 | 0.0 | |
| 224131394 | 718 | predicted protein [Populus trichocarpa] | 0.951 | 0.793 | 0.718 | 0.0 | |
| 356505908 | 724 | PREDICTED: probable translation initiati | 0.946 | 0.783 | 0.712 | 0.0 | |
| 356505910 | 711 | PREDICTED: probable translation initiati | 0.929 | 0.783 | 0.712 | 0.0 | |
| 356573048 | 725 | PREDICTED: probable translation initiati | 0.946 | 0.782 | 0.699 | 0.0 | |
| 356573050 | 716 | PREDICTED: probable translation initiati | 0.928 | 0.776 | 0.700 | 0.0 | |
| 15226869 | 730 | translation initiation factor eIF-2B eps | 0.941 | 0.772 | 0.652 | 0.0 | |
| 297823289 | 726 | eIF4-gamma/eIF5/eIF2-epsilon domain-cont | 0.939 | 0.775 | 0.654 | 0.0 | |
| 307136048 | 636 | eIF4-gamma/eIF5/eIF2-epsilon domain-cont | 0.871 | 0.820 | 0.642 | 0.0 | |
| 449442881 | 635 | PREDICTED: translation initiation factor | 0.869 | 0.820 | 0.635 | 0.0 |
| >gi|297744835|emb|CBI38103.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 899 bits (2322), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 448/599 (74%), Positives = 502/599 (83%), Gaps = 25/599 (4%)
Query: 13 AAARVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAA 72
+ RVSED ++L R PLQAILLADSF KFRPITLERPKVLLPLVNVPMI+YTLAWLE+A
Sbjct: 6 GSTRVSEDAEELVRVPLQAILLADSFAQKFRPITLERPKVLLPLVNVPMIDYTLAWLESA 65
Query: 73 GVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGD 132
G+ EVFVFCCAHSKQVI+YLENS W S P+F V TIESHN +SAGDALRLIYE++VIHGD
Sbjct: 66 GIEEVFVFCCAHSKQVINYLENSHWVSLPHFEVTTIESHNSVSAGDALRLIYERHVIHGD 125
Query: 133 FVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGTDELFMAI 192
FVLI+GDTVSNM LTQALQEHK+R+KKDNNAVMTM+IK+SKPSPITHQSRLGTDELFMAI
Sbjct: 126 FVLITGDTVSNMSLTQALQEHKDRRKKDNNAVMTMVIKRSKPSPITHQSRLGTDELFMAI 185
Query: 193 DPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNF 252
DP+TKQLLYYEDKADH KGT+ L+KMLLA+NPSISLHNDKQDCYIDICSPEVLS+FTDNF
Sbjct: 186 DPHTKQLLYYEDKADHLKGTLSLEKMLLADNPSISLHNDKQDCYIDICSPEVLSIFTDNF 245
Query: 253 DYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPD 312
DYQHLRRHF+KGLL+DDIMGYKIFTHEIHS+YAARIDN+RSYD +SKDIIQRWTYP VPD
Sbjct: 246 DYQHLRRHFIKGLLVDDIMGYKIFTHEIHSNYAARIDNFRSYDTISKDIIQRWTYPLVPD 305
Query: 313 VKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIG 372
V+F GN A KLER+GMYRAL+I QSRSAQ+G F++IG GT IG N+KIS+SVIGE CTIG
Sbjct: 306 VQFLGNCAAKLERQGMYRALDIGQSRSAQIGPFSIIGNGTNIGDNTKISNSVIGERCTIG 365
Query: 373 SNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFK------------ 420
SNV IEGSYIWDNV IEDGC L+H IVC+ VIMK+GAVL+PGV+LSFK
Sbjct: 366 SNVSIEGSYIWDNVTIEDGCVLKHAIVCNDVIMKSGAVLEPGVILSFKVVIGQEFVVPAY 425
Query: 421 --------PTVHDSDEELEYADNSSGTVEFSSIQGTADQSNGEMTSESSEAH---KPKLG 469
PT DSDEELEYAD++SG E SI T D+ NG +T + E ++G
Sbjct: 426 SKVSLLQQPTKQDSDEELEYADHNSGVEEIPSITSTVDKLNGVLTCKLPETEAWSTSEVG 485
Query: 470 TGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTALSTSGELIS 529
+GGVGYIWSICEGG EEEWRHSVAP P DKLTE+ +A DDD EL TQ L SGEL+
Sbjct: 486 SGGVGYIWSICEGGHEEEWRHSVAPTPADKLTEVMQATDDDLELTTQGSNVLLPSGELVP 545
Query: 530 DSNA--SEGDDNEDSKDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCS 586
DSN+ SE DDNEDS+DDSVYFEKEVEATFLRAV ENVK DHVILEVNSLR S + T +
Sbjct: 546 DSNSNISEDDDNEDSRDDSVYFEKEVEATFLRAVHENVKEDHVILEVNSLRLSYNMTSA 604
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224131394|ref|XP_002328528.1| predicted protein [Populus trichocarpa] gi|222838243|gb|EEE76608.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356505908|ref|XP_003521731.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505910|ref|XP_003521732.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356573048|ref|XP_003554677.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356573050|ref|XP_003554678.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15226869|ref|NP_181042.1| translation initiation factor eIF-2B epsilon subunit [Arabidopsis thaliana] gi|3033392|gb|AAC12836.1| putative translation initiation factor eIF-2B epsilon subunit [Arabidopsis thaliana] gi|22655208|gb|AAM98194.1| putative translation initiation factor eIF-2B epsilon subunit [Arabidopsis thaliana] gi|34098787|gb|AAQ56776.1| At2g34970 [Arabidopsis thaliana] gi|330253950|gb|AEC09044.1| translation initiation factor eIF-2B epsilon subunit [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297823289|ref|XP_002879527.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325366|gb|EFH55786.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|307136048|gb|ADN33899.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|449442881|ref|XP_004139209.1| PREDICTED: translation initiation factor eIF-2B subunit epsilon-like [Cucumis sativus] gi|449482909|ref|XP_004156440.1| PREDICTED: translation initiation factor eIF-2B subunit epsilon-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 599 | ||||||
| TAIR|locus:2044712 | 730 | AT2G34970 "AT2G34970" [Arabido | 0.949 | 0.779 | 0.650 | 3.9e-202 | |
| TAIR|locus:2141921 | 709 | AT4G18300 "AT4G18300" [Arabido | 0.923 | 0.779 | 0.598 | 2.6e-173 | |
| TAIR|locus:2076477 | 676 | AT3G02270 "AT3G02270" [Arabido | 0.814 | 0.721 | 0.573 | 3.9e-166 | |
| DICTYBASE|DDB_G0283163 | 707 | eif2b5 "bacterial transferase | 0.911 | 0.772 | 0.363 | 1.8e-96 | |
| POMBASE|SPAC8C9.15c | 678 | tif225 "translation initiation | 0.864 | 0.764 | 0.343 | 3.6e-89 | |
| UNIPROTKB|C0H8R1 | 702 | EI2BE "Translation initiation | 0.888 | 0.757 | 0.371 | 6.7e-88 | |
| ZFIN|ZDB-GENE-030131-5364 | 703 | eif2b5 "eukaryotic translation | 0.909 | 0.775 | 0.359 | 2e-86 | |
| UNIPROTKB|E1BXS9 | 707 | EIF2B5 "Uncharacterized protei | 0.913 | 0.773 | 0.345 | 2.6e-86 | |
| CGD|CAL0005543 | 732 | GCD6 [Candida albicans (taxid: | 0.939 | 0.769 | 0.344 | 6.9e-86 | |
| UNIPROTKB|P87163 | 732 | GCD6 "Translation initiation f | 0.939 | 0.769 | 0.344 | 6.9e-86 |
| TAIR|locus:2044712 AT2G34970 "AT2G34970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1956 (693.6 bits), Expect = 3.9e-202, P = 3.9e-202
Identities = 391/601 (65%), Positives = 464/601 (77%)
Query: 1 MGAQKKRXXXXXXXXRVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVP 60
MGAQKK RVSED + +R LQAILLADSF TKFRP+TLERPKVLLP+VNVP
Sbjct: 1 MGAQKK----GGAAARVSEDAEVQSRHRLQAILLADSFATKFRPVTLERPKVLLPIVNVP 56
Query: 61 MINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDAL 120
MI+YTLAWLE+AG+ EVFVFCCAHS QVI+YLE SEW+S PN V+TIESH ISAGDAL
Sbjct: 57 MIDYTLAWLESAGIEEVFVFCCAHSMQVIEYLEKSEWYSHPNLLVRTIESHKSISAGDAL 116
Query: 121 RLIYEQNV----IHGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSP 176
R +YEQ I GDFVL+SGDTVSNM L +QEH+ERKKKD A+MTM+IK+SK SP
Sbjct: 117 RYMYEQQTETSQIQGDFVLVSGDTVSNMPLADLIQEHRERKKKDEKAIMTMVIKQSKSSP 176
Query: 177 ITHQSRLGTDELFMAIDPNTKQLLYYE-DKADHSKGTICLDKMLLAENPSISLHNDKQDC 235
+THQSRLGTD+LF+A+DP TKQLL+YE DK DH G++CL+K LL NPS+ + ND QDC
Sbjct: 177 LTHQSRLGTDQLFIAVDPLTKQLLHYEEDKIDHPSGSVCLEKSLLDTNPSVLVCNDMQDC 236
Query: 236 YIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYD 295
YIDICSPEVLSLF DNFDYQHLRRHFVKG+L+DDIMGYKIFTHEIHSSYA RIDN+RSYD
Sbjct: 237 YIDICSPEVLSLFEDNFDYQHLRRHFVKGVLVDDIMGYKIFTHEIHSSYAGRIDNFRSYD 296
Query: 296 IVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIG 355
VSKDIIQRWTYPYVPD+ F GNR KL R+G+Y+A ++ QSRSA VG+ TVIGYGTKIG
Sbjct: 297 TVSKDIIQRWTYPYVPDINFSGNRPLKLGRQGIYKASDVVQSRSADVGASTVIGYGTKIG 356
Query: 356 SNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGV 415
KI +SVIG GC+IGSNV+IEGSYIW+NV IEDGCE+R+ IVCDGV ++AGAVL+PGV
Sbjct: 357 HGDKIMNSVIGNGCSIGSNVVIEGSYIWNNVTIEDGCEIRNAIVCDGVKIRAGAVLQPGV 416
Query: 416 VLSFKPTV-HD------SDEEL---EYADNSSGTVEFS-SIQGTADQSNG---EMTSESS 461
VLSF V D S L ++S +E++ S GTAD +G +M S++S
Sbjct: 417 VLSFNVVVGRDFVVPAYSKVSLLQQPTTEDSDEELEYADSSSGTADHLSGLNLQMESKAS 476
Query: 462 EAHKPKLGTGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTAL 521
E LG G GYIW +CEG +EEW+HSVAPIP+DKL+E+++A+DDD T D + +
Sbjct: 477 E-----LGPDGAGYIWEVCEGAHDEEWKHSVAPIPKDKLSEITQAIDDDD---TDDESVV 528
Query: 522 STSGELISDSNASEGDDNEDSKDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSL 581
TSGEL SD+++ D N D DD YFEKEVE T LRAVEEN+KVD V +E+N LR S
Sbjct: 529 PTSGELKSDADSINTDVN-DPNDDYYYFEKEVEGTVLRAVEENIKVDLVTMEINGLRLSF 587
Query: 582 D 582
+
Sbjct: 588 N 588
|
|
| TAIR|locus:2141921 AT4G18300 "AT4G18300" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2076477 AT3G02270 "AT3G02270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0283163 eif2b5 "bacterial transferase hexapeptide repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC8C9.15c tif225 "translation initiation factor eIF2B epsilon subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C0H8R1 EI2BE "Translation initiation factor eIF-2B subunit epsilon" [Salmo salar (taxid:8030)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5364 eif2b5 "eukaryotic translation initiation factor 2B, subunit 5 epsilon" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BXS9 EIF2B5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0005543 GCD6 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P87163 GCD6 "Translation initiation factor eIF-2B subunit epsilon" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00036700001 | SubName- Full=Chromosome chr15 scaffold_82, whole genome shotgun sequence; (667 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00023929001 | • | • | • | • | 0.960 | ||||||
| GSVIVG00031929001 | • | • | • | • | 0.922 | ||||||
| GSVIVG00029350001 | • | • | • | • | 0.915 | ||||||
| GSVIVG00024042001 | • | • | • | • | 0.915 | ||||||
| GSVIVG00034005001 | • | • | • | • | 0.887 | ||||||
| GSVIVG00031027001 | • | • | • | 0.761 | |||||||
| GSVIVG00035007001 | • | • | • | • | 0.633 | ||||||
| GSVIVG00015309001 | • | • | • | 0.601 | |||||||
| GSVIVG00002292001 | • | • | 0.509 | ||||||||
| GSVIVG00038167001 | • | • | • | • | 0.498 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 599 | |||
| cd04197 | 217 | cd04197, eIF-2B_epsilon_N, The N-terminal domain o | 2e-95 | |
| cd02507 | 216 | cd02507, eIF-2B_gamma_N_like, The N-terminal of eI | 3e-74 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 1e-45 | |
| cd05787 | 79 | cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit | 1e-34 | |
| cd04198 | 214 | cd04198, eIF-2B_gamma_N, The N-terminal domain of | 7e-26 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 1e-18 | |
| cd04181 | 217 | cd04181, NTP_transferase, NTP_transferases catalyz | 7e-18 | |
| cd04652 | 81 | cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, | 1e-15 | |
| COG0448 | 393 | COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb | 1e-12 | |
| cd06422 | 221 | cd06422, NTP_transferase_like_1, NTP_transferase_l | 1e-11 | |
| TIGR03992 | 393 | TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph | 5e-11 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 1e-10 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 2e-10 | |
| cd06915 | 223 | cd06915, NTP_transferase_WcbM_like, WcbM_like is a | 3e-10 | |
| TIGR02092 | 369 | TIGR02092, glgD, glucose-1-phosphate adenylyltrans | 5e-10 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 6e-10 | |
| TIGR02091 | 361 | TIGR02091, glgC, glucose-1-phosphate adenylyltrans | 5e-09 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 8e-09 | |
| cd04652 | 81 | cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, | 1e-08 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 1e-08 | |
| cd06425 | 233 | cd06425, M1P_guanylylT_B_like_N, N-terminal domain | 1e-08 | |
| cd03350 | 139 | cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyri | 5e-08 | |
| cd02523 | 229 | cd02523, PC_cytidylyltransferase, Phosphocholine c | 7e-08 | |
| cd04189 | 236 | cd04189, G1P_TT_long, G1P_TT_long represents the l | 8e-08 | |
| cd11558 | 169 | cd11558, W2_eIF2B_epsilon, C-terminal W2 domain of | 9e-08 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 2e-07 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 3e-07 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 3e-07 | |
| PRK05293 | 380 | PRK05293, glgC, glucose-1-phosphate adenylyltransf | 3e-07 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 6e-07 | |
| PRK05293 | 380 | PRK05293, glgC, glucose-1-phosphate adenylyltransf | 6e-07 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 6e-07 | |
| PRK14355 | 459 | PRK14355, glmU, bifunctional N-acetylglucosamine-1 | 9e-07 | |
| cd04645 | 153 | cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra | 1e-06 | |
| cd06428 | 257 | cd06428, M1P_guanylylT_A_like_N, N-terminal domain | 1e-06 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 1e-06 | |
| COG1209 | 286 | COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel | 2e-06 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 3e-06 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 3e-06 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 4e-06 | |
| cd03360 | 197 | cd03360, LbH_AT_putative, Putative Acyltransferase | 4e-06 | |
| COG1213 | 239 | COG1213, COG1213, Predicted sugar nucleotidyltrans | 4e-06 | |
| cd04647 | 109 | cd04647, LbH_MAT_like, Maltose O-acyltransferase ( | 4e-06 | |
| TIGR01208 | 353 | TIGR01208, rmlA_long, glucose-1-phosphate thymidyl | 5e-06 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 6e-06 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 9e-06 | |
| PRK00844 | 407 | PRK00844, glgC, glucose-1-phosphate adenylyltransf | 1e-05 | |
| COG0663 | 176 | COG0663, PaaY, Carbonic anhydrases/acetyltransfera | 1e-05 | |
| cd03354 | 101 | cd03354, LbH_SAT, Serine acetyltransferase (SAT): | 1e-05 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 2e-05 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 2e-05 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 3e-05 | |
| PRK11830 | 272 | PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-car | 3e-05 | |
| COG4750 | 231 | COG4750, LicC, CTP:phosphocholine cytidylyltransfe | 3e-05 | |
| pfam00483 | 247 | pfam00483, NTP_transferase, Nucleotidyl transferas | 3e-05 | |
| cd03359 | 161 | cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p2 | 4e-05 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 5e-05 | |
| cd06426 | 220 | cd06426, NTP_transferase_like_2, NTP_trnasferase_l | 6e-05 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 6e-05 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 2e-04 | |
| PRK00844 | 407 | PRK00844, glgC, glucose-1-phosphate adenylyltransf | 2e-04 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 4e-04 | |
| cd00710 | 167 | cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( | 4e-04 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 5e-04 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 5e-04 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 6e-04 | |
| PRK15480 | 292 | PRK15480, PRK15480, glucose-1-phosphate thymidylyl | 9e-04 | |
| cd02508 | 200 | cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory | 0.001 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 0.001 | |
| cd02540 | 229 | cd02540, GT2_GlmU_N_bac, N-terminal domain of bact | 0.001 | |
| PRK14360 | 450 | PRK14360, glmU, bifunctional N-acetylglucosamine-1 | 0.001 | |
| PRK00725 | 425 | PRK00725, glgC, glucose-1-phosphate adenylyltransf | 0.001 | |
| COG1210 | 291 | COG1210, GalU, UDP-glucose pyrophosphorylase [Cell | 0.001 | |
| TIGR01208 | 353 | TIGR01208, rmlA_long, glucose-1-phosphate thymidyl | 0.002 | |
| TIGR02623 | 254 | TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti | 0.002 | |
| COG0110 | 190 | COG0110, WbbJ, Acetyltransferase (isoleucine patch | 0.002 | |
| TIGR01207 | 286 | TIGR01207, rmlA, glucose-1-phosphate thymidylyltra | 0.002 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 0.003 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 0.003 | |
| PLN02241 | 436 | PLN02241, PLN02241, glucose-1-phosphate adenylyltr | 0.003 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 0.004 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 0.004 |
| >gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
Score = 291 bits (746), Expect = 2e-95
Identities = 105/220 (47%), Positives = 149/220 (67%), Gaps = 6/220 (2%)
Query: 29 LQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQV 88
LQA++LADSF +FRP+T E+P+ LLPL NVP+I+YTL +L GV EVFVFCC+HS Q+
Sbjct: 1 LQAVVLADSFNRRFRPLTKEKPRCLLPLANVPLIDYTLEFLALNGVEEVFVFCCSHSDQI 60
Query: 89 IDYLENSEWFSQPN--FTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLL 146
+Y+E S+W + V I S + S GDALR + + +I GDF+L+SGD VSN+ L
Sbjct: 61 KEYIEKSKWSKPKSSLMIVIIIMSEDCRSLGDALRDLDAKGLIRGDFILVSGDVVSNIDL 120
Query: 147 TQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDK- 205
+ L+EHKER+KKD NA+MTM++K++ P H++R +E +A+DP T +LL+YE+
Sbjct: 121 KEILEEHKERRKKDKNAIMTMVLKEASPP---HRTRRTGEEFVIAVDPKTSRLLHYEELP 177
Query: 206 ADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVL 245
+ L LL N + + +D DC+IDICSP+VL
Sbjct: 178 GSKYRSITDLPSELLGSNSEVEIRHDLLDCHIDICSPDVL 217
|
N-terminal domain of epsilon subunit of the eukaryotic translation initiation factor 2B (eIF-2B): eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit epsilon shares sequence similarity with gamma subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 217 |
| >gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >gnl|CDD|233721 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
| >gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|211396 cd11558, W2_eIF2B_epsilon, C-terminal W2 domain of eukaryotic translation initiation factor 2B epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >gnl|CDD|224134 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >gnl|CDD|236996 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227093 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 599 | |||
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 100.0 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 100.0 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 100.0 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 100.0 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 100.0 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 100.0 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 100.0 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 100.0 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 100.0 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 100.0 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| cd04197 | 217 | eIF-2B_epsilon_N The N-terminal domain of epsilon | 100.0 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 100.0 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 100.0 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| cd04198 | 214 | eIF-2B_gamma_N The N-terminal domain of gamma subu | 100.0 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| COG1209 | 286 | RfbA dTDP-glucose pyrophosphorylase [Cell envelope | 100.0 | |
| cd02507 | 216 | eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma | 100.0 | |
| TIGR01105 | 297 | galF UTP-glucose-1-phosphate uridylyltransferase, | 99.97 | |
| PF00483 | 248 | NTP_transferase: Nucleotidyl transferase This Pros | 99.97 | |
| cd06425 | 233 | M1P_guanylylT_B_like_N N-terminal domain of the M1 | 99.97 | |
| PRK10122 | 297 | GalU regulator GalF; Provisional | 99.97 | |
| cd06428 | 257 | M1P_guanylylT_A_like_N N-terminal domain of M1P_gu | 99.97 | |
| PRK15480 | 292 | glucose-1-phosphate thymidylyltransferase RfbA; Pr | 99.97 | |
| cd02538 | 240 | G1P_TT_short G1P_TT_short is the short form of glu | 99.96 | |
| TIGR02623 | 254 | G1P_cyt_trans glucose-1-phosphate cytidylyltransfe | 99.96 | |
| TIGR01207 | 286 | rmlA glucose-1-phosphate thymidylyltransferase, sh | 99.96 | |
| cd06422 | 221 | NTP_transferase_like_1 NTP_transferase_like_1 is a | 99.96 | |
| cd02541 | 267 | UGPase_prokaryotic Prokaryotic UGPase catalyses th | 99.96 | |
| PRK13389 | 302 | UTP--glucose-1-phosphate uridylyltransferase subun | 99.96 | |
| TIGR01099 | 260 | galU UTP-glucose-1-phosphate uridylyltransferase. | 99.96 | |
| cd04189 | 236 | G1P_TT_long G1P_TT_long represents the long form o | 99.95 | |
| cd02524 | 253 | G1P_cytidylyltransferase G1P_cytidylyltransferase | 99.95 | |
| cd06426 | 220 | NTP_transferase_like_2 NTP_trnasferase_like_2 is a | 99.95 | |
| cd04181 | 217 | NTP_transferase NTP_transferases catalyze the tran | 99.95 | |
| cd06915 | 223 | NTP_transferase_WcbM_like WcbM_like is a subfamily | 99.94 | |
| COG1210 | 291 | GalU UDP-glucose pyrophosphorylase [Cell envelope | 99.92 | |
| cd02523 | 229 | PC_cytidylyltransferase Phosphocholine cytidylyltr | 99.91 | |
| cd02508 | 200 | ADP_Glucose_PP ADP-glucose pyrophosphorylase is in | 99.9 | |
| cd04183 | 231 | GT2_BcE_like GT2_BcbE_like is likely involved in t | 99.88 | |
| cd02509 | 274 | GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf | 99.87 | |
| cd02540 | 229 | GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | 99.82 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 99.82 | |
| PRK05450 | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 99.79 | |
| COG1213 | 239 | Predicted sugar nucleotidyltransferases [Cell enve | 99.77 | |
| cd02517 | 239 | CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th | 99.77 | |
| PRK13368 | 238 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 99.71 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.65 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 99.64 | |
| COG0836 | 333 | {ManC} Mannose-1-phosphate guanylyltransferase [Ce | 99.63 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.6 | |
| COG4750 | 231 | LicC CTP:phosphocholine cytidylyltransferase invol | 99.53 | |
| TIGR00454 | 183 | conserved hypothetical protein TIGR00454. At this | 99.48 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.47 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.46 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.43 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.42 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.4 | |
| PLN02917 | 293 | CMP-KDO synthetase | 99.39 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.39 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.39 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.38 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.38 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.38 | |
| PF12804 | 160 | NTP_transf_3: MobA-like NTP transferase domain; PD | 99.37 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.35 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.35 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.34 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.34 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.33 | |
| PLN02472 | 246 | uncharacterized protein | 99.33 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.33 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.32 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.32 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.31 | |
| PLN02296 | 269 | carbonate dehydratase | 99.31 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.3 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.3 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.3 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.29 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.29 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.29 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.28 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.28 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.28 | |
| PLN02472 | 246 | uncharacterized protein | 99.27 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.27 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.27 | |
| PLN02296 | 269 | carbonate dehydratase | 99.27 | |
| cd04182 | 186 | GT_2_like_f GT_2_like_f is a subfamily of the glyc | 99.27 | |
| TIGR03310 | 188 | matur_ygfJ molybdenum hydroxylase accessory protei | 99.26 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.26 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.26 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.25 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.24 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.24 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.23 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.23 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.22 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.22 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.22 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.22 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.22 | |
| TIGR00466 | 238 | kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe | 99.21 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.2 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.19 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.19 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.19 | |
| COG2266 | 177 | GTP:adenosylcobinamide-phosphate guanylyltransfera | 99.19 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.18 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.18 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.16 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.16 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.16 | |
| cd02513 | 223 | CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- | 99.15 | |
| TIGR00453 | 217 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 99.15 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.14 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.14 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.14 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.13 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.13 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.13 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.12 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.12 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.11 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.11 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.1 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.1 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.09 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.06 | |
| PRK09382 | 378 | ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp | 99.06 | |
| cd02503 | 181 | MobA MobA catalyzes the formation of molybdopterin | 99.05 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.04 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.04 | |
| COG2068 | 199 | Uncharacterized MobA-related protein [General func | 99.01 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.01 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.0 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.0 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.0 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.99 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.99 | |
| TIGR03202 | 190 | pucB xanthine dehydrogenase accessory protein pucB | 98.98 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 98.97 | |
| PRK00317 | 193 | mobA molybdopterin-guanine dinucleotide biosynthes | 98.96 | |
| TIGR02665 | 186 | molyb_mobA molybdopterin-guanine dinucleotide bios | 98.96 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.96 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 98.96 | |
| cd02516 | 218 | CDP-ME_synthetase CDP-ME synthetase is involved in | 98.96 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 98.94 | |
| PRK00155 | 227 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 98.94 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.94 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 98.93 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.93 | |
| PLN02728 | 252 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 98.92 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.91 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 98.9 | |
| PRK02726 | 200 | molybdopterin-guanine dinucleotide biosynthesis pr | 98.88 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 98.87 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.86 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 98.86 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.85 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 98.85 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 98.84 | |
| PRK13385 | 230 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 98.83 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.81 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 98.81 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 98.8 | |
| PLN02694 | 294 | serine O-acetyltransferase | 98.8 | |
| cd02518 | 233 | GT2_SpsF SpsF is a glycosyltrnasferase implicated | 98.79 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.79 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 98.79 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.78 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 98.78 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.78 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 98.76 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 98.76 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.76 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 98.75 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 98.74 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 98.72 | |
| cd04180 | 266 | UGPase_euk_like Eukaryotic UGPase-like includes UD | 98.72 | |
| TIGR03584 | 222 | PseF pseudaminic acid CMP-transferase. The sequenc | 98.7 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.7 | |
| PLN02357 | 360 | serine acetyltransferase | 98.7 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 98.69 | |
| PLN02739 | 355 | serine acetyltransferase | 98.69 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.68 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 98.68 | |
| PLN02357 | 360 | serine acetyltransferase | 98.67 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 98.67 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 98.66 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 98.64 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 98.64 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 98.63 | |
| COG1212 | 247 | KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase | 98.63 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.63 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 98.62 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.61 | |
| PLN02694 | 294 | serine O-acetyltransferase | 98.61 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.61 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.6 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.6 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.6 | |
| PLN02739 | 355 | serine acetyltransferase | 98.59 | |
| PF01128 | 221 | IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly | 98.59 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.59 | |
| cd04193 | 323 | UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala | 98.56 | |
| PRK00560 | 196 | molybdopterin-guanine dinucleotide biosynthesis pr | 98.56 | |
| COG0746 | 192 | MobA Molybdopterin-guanine dinucleotide biosynthes | 98.54 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.53 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 98.52 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 98.49 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.47 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 98.47 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.47 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.47 | |
| PRK14500 | 346 | putative bifunctional molybdopterin-guanine dinucl | 98.42 | |
| COG1211 | 230 | IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt | 98.37 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.37 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.35 | |
| PTZ00339 | 482 | UDP-N-acetylglucosamine pyrophosphorylase; Provisi | 98.32 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 98.31 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.26 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.26 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.19 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 97.99 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 97.81 | |
| PF02348 | 217 | CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 | 97.79 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 97.79 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 97.77 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 97.77 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 97.76 | |
| PLN02474 | 469 | UTP--glucose-1-phosphate uridylyltransferase | 97.64 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 97.59 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 97.42 | |
| COG1083 | 228 | NeuA CMP-N-acetylneuraminic acid synthetase [Cell | 97.32 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 97.29 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 97.24 | |
| cd00897 | 300 | UGPase_euk Eukaryotic UGPase catalyses the synthes | 97.19 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.04 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 96.99 | |
| PLN02435 | 493 | probable UDP-N-acetylglucosamine pyrophosphorylase | 96.94 | |
| PRK00576 | 178 | molybdopterin-guanine dinucleotide biosynthesis pr | 96.88 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 96.87 | |
| PRK13412 | 974 | fkp bifunctional fucokinase/L-fucose-1-P-guanylylt | 96.74 | |
| COG1861 | 241 | SpsF Spore coat polysaccharide biosynthesis protei | 96.53 | |
| PLN02830 | 615 | UDP-sugar pyrophosphorylase | 96.51 | |
| cd06424 | 315 | UGGPase UGGPase catalyzes the synthesis of UDP-Glu | 96.51 | |
| COG4284 | 472 | UDP-glucose pyrophosphorylase [Carbohydrate transp | 96.46 | |
| PF01704 | 420 | UDPGP: UTP--glucose-1-phosphate uridylyltransferas | 96.02 | |
| TIGR03552 | 195 | F420_cofC 2-phospho-L-lactate guanylyltransferase | 95.64 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 95.61 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 93.27 | |
| cd00761 | 156 | Glyco_tranf_GTA_type Glycosyltransferase family A | 91.85 | |
| PF00535 | 169 | Glycos_transf_2: Glycosyl transferase family 2; In | 82.37 |
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-112 Score=901.03 Aligned_cols=548 Identities=50% Similarity=0.825 Sum_probs=467.9
Q ss_pred CchhhhHHHHHHHHhccCCCCCcccCCCcEEEEEeCCCCCCCCCCCCCCCcccceeCCcchHHHHHHHHHHCCCcEEEEE
Q 007537 1 MGAQKKRAAAAAAAARVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVF 80 (599)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~aVILA~g~gtR~~PlT~~~PK~LLpi~n~PlI~y~Le~L~~~gv~eV~vv 80 (599)
|++++|++ ||...-++. +...++++|||+||++|.+||+|+|..+|++||||+|.|||+|+|+||..+||++|||+
T Consensus 1 M~~~k~~~--~~~~~~~~~--~~~~~~rLqAIllaDsf~trF~Plt~~~p~~LLPlaNVpmIdYtL~~L~~agV~eVfvf 76 (673)
T KOG1461|consen 1 MAKKKKRP--AALGETGKE--ENFREHRLQAILLADSFETRFRPLTLEKPRVLLPLANVPMIDYTLEWLERAGVEEVFVF 76 (673)
T ss_pred CCcccCcc--cccccCccc--ccccccceEEEEEeccchhcccccccCCCceEeeecCchHHHHHHHHHHhcCceEEEEE
Confidence 67777662 222222222 22228999999999999999999999999999999999999999999999999999999
Q ss_pred ccCchHHHHHHHHhcccCCCCCceEEEEecCCcCCHHHHHHHHHHhcccCCCEEEEcCCeechhhHHHHHHHHHHhhccC
Q 007537 81 CCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQEHKERKKKD 160 (599)
Q Consensus 81 ~~~~~~~i~~~l~~~~w~~~~~~~i~~v~~~~~~~~g~alr~~~~~~~i~~dfllv~gD~v~~~~l~~ll~~h~~~~~~d 160 (599)
|+.|..||.+|+++++|.....+.+..|....++++|||||++++++++.+||+|++||+++|++|.++|++||+|++.|
T Consensus 77 c~~~~~qi~e~i~~sew~~~~~~~v~ti~s~~~~S~GDamR~id~k~litgDFiLVsgd~vsN~pl~~~l~eHr~r~k~D 156 (673)
T KOG1461|consen 77 CSAHAAQIIEYIEKSEWYLPMSFIVVTICSGESRSVGDAMRDIDEKQLITGDFILVSGDTVSNMPLRNVLEEHRKRRKED 156 (673)
T ss_pred ecccHHHHHHHHhhccccccccceEEEEcCCCcCcHHHHHHHHHhcceeecceEEEeCCeeecCchHHHHHHHHHHhhhC
Confidence 99999999999999999988777788888888999999999999999999999999999999999999999999999999
Q ss_pred CCceEEEEEeecCCCCCccCcccCCCceEEEEeCCCCeEEEeeccCCCCCCceEeeHHhHhcCCceEEEcCCccceeEee
Q 007537 161 NNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDIC 240 (599)
Q Consensus 161 ~~a~mT~~~~~~~~~~~~~~~r~g~~~~vv~~d~~~~rvl~~~ekp~~~~~~~~i~~~~~~~~~~~~ir~dL~d~gIyic 240 (599)
|+++|||++++.+ +|.+.+..++++|+.|.||++|++.. ..++.+.+++++|..++.+.+|+||+||+|+||
T Consensus 157 k~~iMTmv~k~~s-------t~~~~~~~~~avd~~T~~ll~yq~~~-~~~~~~~l~~sl~d~~~~v~vr~DL~dc~IdIc 228 (673)
T KOG1461|consen 157 KDAIMTMVFKESS-------TRETTEQVVIAVDSRTSRLLHYQKCV-REKHDIQLDLSLFDSNDEVEVRNDLLDCQIDIC 228 (673)
T ss_pred ccceEEEEEeccc-------cccCCcceEEEEcCCcceEEeehhhc-ccccccccCHHHhcCCCcEEEEccCCCceeeEe
Confidence 9999999999975 36667788999999999999999732 345689999999999999999999999999999
Q ss_pred ChhhHhhhccccchhhHHHhhhhccccccccCCeeEEEecccc-ceeeccChhHHHHHHHHhhhccccccCCCCccCCCC
Q 007537 241 SPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSS-YAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNR 319 (599)
Q Consensus 241 sp~vl~lf~dnfd~q~ir~dfv~~vl~~~~~g~~I~~~~~~~~-y~~~V~s~~sY~~as~dil~rw~~p~~p~~~~~~~~ 319 (599)
||+|+.+|+|||||| +|.||++|+|..+++|++||+|.+.+. |+.||.+|++|..+|+|+|+||+||++|+.+|.+++
T Consensus 229 S~~V~sLF~dNFDyq-~r~DfV~GvL~~dilg~kI~~~~~~~~~yA~rv~n~~syd~vSkDiI~RW~YP~Vpd~~~~~~q 307 (673)
T KOG1461|consen 229 SPEVLSLFTDNFDYQ-TRDDFVRGVLVDDILGYKIHVHVLSSIDYAARVENLRSYDLVSKDIIQRWTYPLVPDINFSGNQ 307 (673)
T ss_pred cHhHHHHhhhcccce-ehhhhhhhhhhhhhcCCeEEEEEcChhhhhhhhcccHHHHHHHHHHHHhhcccccccccCCCCc
Confidence 999999999999999 799999999999999999999999865 999999999999999999999999999999999989
Q ss_pred cceeeecceEECCCcEECCCCEECCCcEECCCCEECCCCEEeceEECCCCEECCCcEEeceEECCCCEECCCcEEeceEE
Q 007537 320 ATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIV 399 (599)
Q Consensus 320 ~~~~~~~~~~~~~~~~i~~~~~I~~~~~Ig~~~~Ig~~~~I~~svIG~~~~Ig~~~~I~~s~I~~~v~Ig~~~~I~~siI 399 (599)
++++.|.++|+++.+++.++|.++.+++||.+|.||.|++|.||+||.||.||.||+|.+|+||+||+||+||+|.+|+|
T Consensus 308 ~~~~~r~~IYk~~dv~~~~~~~v~~~~~ig~gT~Ig~g~~I~NSVIG~~c~IgsN~~I~~S~iw~~v~Igdnc~I~~aii 387 (673)
T KOG1461|consen 308 TFSLERRNIYKSPDVVLSHSVIVGANVVIGAGTKIGSGSKISNSVIGANCRIGSNVRIKNSFIWNNVTIGDNCRIDHAII 387 (673)
T ss_pred eeeecccccccCccceehhhccccceEEecccccccCCCeeecceecCCCEecCceEEeeeeeecCcEECCCceEeeeEe
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCEECCCCEECCCCEECCCCCcCCChhhhhhccCCCCccccccccCcccCCCC---ccccC-CccCCCCCcCCCCcee
Q 007537 400 CDGVIMKAGAVLKPGVVLSFKPTVHDSDEELEYADNSSGTVEFSSIQGTADQSNG---EMTSE-SSEAHKPKLGTGGVGY 475 (599)
Q Consensus 400 ~~~~~Ig~~~~I~~g~vig~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~-~~~~~~~~~g~~g~g~ 475 (599)
|++|+|+++|+|.+|||||+++.+++. ..+|.++++... +.+.+ .-....+-+|+.|.||
T Consensus 388 ~d~v~i~~~~~l~~g~vl~~~VVv~~~----------------~~l~~ns~~~~p~~eesdee~~~~~~l~siG~~G~gy 451 (673)
T KOG1461|consen 388 CDDVKIGEGAILKPGSVLGFGVVVGRN----------------FVLPKNSKVRQPTTEESDEEGLDDVKLKSIGPDGAGY 451 (673)
T ss_pred ecCcEeCCCcccCCCcEEeeeeEeCCC----------------ccccccccccCCcccccchhhccchheeeccCCccee
Confidence 999999999999999999999887753 134444333211 11000 0001112289999999
Q ss_pred eeeccCCCchhhhcccCCCCCcchhhhccccCcchhhhhccccccccCCCccccCCCCCCCCCCC-CCCCchhhHHHHHH
Q 007537 476 IWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTALSTSGELISDSNASEGDDNE-DSKDDSVYFEKEVE 554 (599)
Q Consensus 476 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~s~~~~~~-~~~~~~~~F~~e~~ 554 (599)
+|.. ++.+||+|.+...+.++.++...+.++++++ + .|.++++++.+ +.++|+..|++||.
T Consensus 452 i~~~-~~~~dee~~~~~~~~~~~k~n~~~~~Dd~~s------e-----------~s~~~~edd~~~~in~d~~~F~~Ev~ 513 (673)
T KOG1461|consen 452 IWET-EDADDEEWKPLVPPSPNDKTNEAIEDDDSES------E-----------SSVSEEEDDASTDINDDTKDFEKEVL 513 (673)
T ss_pred eecc-cCcccccccccccCCcccccccccccccchh------h-----------ccccccccccccccCchhHHHHHHHH
Confidence 9975 3345667777666666655442222222110 0 11112222222 33457889999999
Q ss_pred HHHHHHHHcCCCCCceeeeecccccccCCChhHhhcccccC
Q 007537 555 ATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGFF 595 (599)
Q Consensus 555 ~~~~r~~~~~~~~d~~~le~~~~r~a~n~~~~~~~~~~~~~ 595 (599)
+||+||+|||+++|+++||||||||||||+++||+++.-++
T Consensus 514 ~s~~ra~Een~~~D~~vlEINslRla~N~s~~ev~~av~~a 554 (673)
T KOG1461|consen 514 GSLQRAFEENSDMDNLVLEINSLRLAYNVSLKEVAGAVFMA 554 (673)
T ss_pred HHHHHHHHhccchHHHHHHHhhhHHhhcCCHHHHHHHHHHH
Confidence 99999999999999999999999999999999999986443
|
|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit | Back alignment and domain information |
|---|
| >PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry | Back alignment and domain information |
|---|
| >cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >PRK10122 GalU regulator GalF; Provisional | Back alignment and domain information |
|---|
| >cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional | Back alignment and domain information |
|---|
| >cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form | Back alignment and domain information |
|---|
| >cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional | Back alignment and domain information |
|---|
| >TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose | Back alignment and domain information |
|---|
| >cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
| >cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch | Back alignment and domain information |
|---|
| >cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule | Back alignment and domain information |
|---|
| >cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose | Back alignment and domain information |
|---|
| >cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide | Back alignment and domain information |
|---|
| >PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00454 conserved hypothetical protein TIGR00454 | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >PLN02917 CMP-KDO synthetase | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function | Back alignment and domain information |
|---|
| >TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety | Back alignment and domain information |
|---|
| >TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional | Back alignment and domain information |
|---|
| >cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >COG2068 Uncharacterized MobA-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03202 pucB xanthine dehydrogenase accessory protein pucB | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes | Back alignment and domain information |
|---|
| >TIGR03584 PseF pseudaminic acid CMP-transferase | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate [] | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc | Back alignment and domain information |
|---|
| >PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional | Back alignment and domain information |
|---|
| >COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02474 UTP--glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02830 UDP-sugar pyrophosphorylase | Back alignment and domain information |
|---|
| >cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose | Back alignment and domain information |
|---|
| >COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2 | Back alignment and domain information |
|---|
| >TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold | Back alignment and domain information |
|---|
| >PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 599 | ||||
| 2ggo_A | 401 | Crystal Structure Of Glucose-1-Phosphate Thymidylyl | 1e-04 | ||
| 1jyk_A | 254 | Catalytic Mechanism Of Ctp:phosphocholine Cytidylyt | 2e-04 | ||
| 1jyl_A | 254 | Catalytic Mechanism Of Ctp:phosphocholine Cytidylyt | 2e-04 | ||
| 3pkp_A | 292 | Q83s Variant Of S. Enterica Rmla With Datp Length = | 2e-04 | ||
| 3pkq_A | 292 | Q83d Variant Of S. Enterica Rmla With Dgtp Length = | 3e-04 | ||
| 1mp4_A | 292 | W224h Variant Of S. Enterica Rmla Length = 292 | 4e-04 | ||
| 1iim_A | 292 | Thymidylyltransferase Complexed With Ttp Length = 2 | 5e-04 | ||
| 1mp5_A | 292 | Y177f Variant Of S. Enterica Rmla Length = 292 | 6e-04 | ||
| 1h5t_A | 293 | Thymidylyltransferase Complexed With Thymidylyldiph | 7e-04 | ||
| 1h5r_B | 293 | Thymidylyltransferase Complexed With Thimidine And | 7e-04 | ||
| 1h5s_A | 293 | Thymidylyltransferase Complexed With Tmp Length = 2 | 8e-04 |
| >pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 | Back alignment and structure |
|
| >pdb|1JYK|A Chain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 | Back alignment and structure |
| >pdb|1JYL|A Chain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 | Back alignment and structure |
| >pdb|3PKP|A Chain A, Q83s Variant Of S. Enterica Rmla With Datp Length = 292 | Back alignment and structure |
| >pdb|3PKQ|A Chain A, Q83d Variant Of S. Enterica Rmla With Dgtp Length = 292 | Back alignment and structure |
| >pdb|1MP4|A Chain A, W224h Variant Of S. Enterica Rmla Length = 292 | Back alignment and structure |
| >pdb|1IIM|A Chain A, Thymidylyltransferase Complexed With Ttp Length = 292 | Back alignment and structure |
| >pdb|1MP5|A Chain A, Y177f Variant Of S. Enterica Rmla Length = 292 | Back alignment and structure |
| >pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 | Back alignment and structure |
| >pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 | Back alignment and structure |
| >pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 599 | |||
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 4e-15 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 4e-13 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 2e-11 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 3e-09 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 5e-09 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 3rsb_A | 196 | Adenosylcobinamide-phosphate guanylyltransferase; | 1e-11 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 1e-09 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 2e-06 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 1e-09 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 1e-08 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 2e-09 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 4e-05 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 8e-05 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 2e-09 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 5e-05 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 6e-05 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 3e-09 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 2e-08 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 9e-05 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 5e-04 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 4e-09 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 5e-09 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 8e-09 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 1e-06 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 3e-06 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 1e-04 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 1e-08 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 7e-08 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 9e-08 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 1e-04 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 4e-07 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 5e-04 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 6e-07 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 5e-04 | |
| 3jui_A | 182 | Translation initiation factor EIF-2B subunit EPSI; | 7e-07 | |
| 1paq_A | 189 | Translation initiation factor EIF-2B epsilon subun | 9e-07 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 1e-06 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 2e-06 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 4e-06 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 5e-06 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 1e-05 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 2e-05 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 2e-05 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 2e-05 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 2e-04 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 2e-05 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 3e-05 | |
| 4evw_A | 255 | Nucleoside-diphosphate-sugar pyrophosphorylase; st | 3e-05 | |
| 2dpw_A | 232 | Hypothetical protein TTHA0179; transferase, struct | 2e-04 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 5e-04 | |
| 2waw_A | 199 | MOBA relate protein; unknown function; HET: PGE; 1 | 6e-04 | |
| 2wee_A | 197 | MOBA-related protein; unknown function; 1.65A {Myc | 7e-04 |
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 | Back alignment and structure |
|---|
Score = 74.4 bits (183), Expect = 4e-15
Identities = 24/132 (18%), Positives = 56/132 (42%), Gaps = 8/132 (6%)
Query: 22 DDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFC 81
+ ++AI+LA T+ RP+T PK L+ + P+I Y + +L+ G+ ++ +
Sbjct: 19 SHMKEIRVKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDI-III 77
Query: 82 CAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTV 141
+ K+ DYL+ + V+ + + + L + + +V+ + + +
Sbjct: 78 VGYLKEQFDYLKE-------KYGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYL 130
Query: 142 SNMLLTQALQEH 153
+ L
Sbjct: 131 FKNMFRNDLTRS 142
|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >3jui_A Translation initiation factor EIF-2B subunit EPSI; heat repeat, guanine nucleotide exchange factor, disease mutation, leukodystrophy; 2.00A {Homo sapiens} Length = 182 | Back alignment and structure |
|---|
| >1paq_A Translation initiation factor EIF-2B epsilon subunit; heat repeat, AA motif; 2.30A {Saccharomyces cerevisiae} SCOP: a.118.1.14 Length = 189 | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} Length = 187 | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Length = 189 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Length = 191 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Length = 173 | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Length = 173 | Back alignment and structure |
|---|
| >4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 | Back alignment and structure |
|---|
| >2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Length = 232 | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 | Back alignment and structure |
|---|
| >2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Length = 199 | Back alignment and structure |
|---|
| >2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Length = 197 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 599 | |||
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 100.0 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 100.0 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 100.0 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 100.0 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 100.0 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 100.0 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 100.0 | |
| 3juk_A | 281 | UDP-glucose pyrophosphorylase (GALU); transfer; HE | 99.96 | |
| 4ecm_A | 269 | Glucose-1-phosphate thymidylyltransferase; HET: DA | 99.95 | |
| 1tzf_A | 259 | Glucose-1-phosphate cytidylyltransferase; nucleoti | 99.95 | |
| 2ux8_A | 297 | Glucose-1-phosphate uridylyltransferase; UGPG, GAL | 99.94 | |
| 2e3d_A | 302 | UTP--glucose-1-phosphate uridylyltransferase; UDP- | 99.94 | |
| 2pa4_A | 323 | UTP-glucose-1-phosphate uridylyltransferase; phosp | 99.93 | |
| 1lvw_A | 295 | Glucose-1-phosphate thymidylyltransferase; protein | 99.93 | |
| 3pnn_A | 303 | Conserved domain protein; structural genomics, PSI | 99.93 | |
| 1fxo_A | 293 | Glucose-1-phosphate thymidylyltransferase; rhamnos | 99.92 | |
| 1mc3_A | 296 | Glucose-1-phosphate thymidylyltransferase; glucose | 99.92 | |
| 4evw_A | 255 | Nucleoside-diphosphate-sugar pyrophosphorylase; st | 99.9 | |
| 2qh5_A | 308 | PMI, ALGA, mannose-6-phosphate isomerase; structur | 99.9 | |
| 2x65_A | 336 | Mannose-1-phosphate guanylyltransferase; nucleotid | 99.87 | |
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 99.86 | |
| 3oam_A | 252 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 99.86 | |
| 2cu2_A | 337 | Putative mannose-1-phosphate guanylyl transferase; | 99.85 | |
| 3k8d_A | 264 | 3-deoxy-manno-octulosonate cytidylyltransferase; K | 99.77 | |
| 3tqd_A | 256 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 99.77 | |
| 2y6p_A | 234 | 3-deoxy-manno-octulosonate cytidylyltransferase; l | 99.75 | |
| 2icy_A | 469 | Probable UTP-glucose-1-phosphate uridylyltransfera | 99.73 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 99.72 | |
| 1h7e_A | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; n | 99.7 | |
| 4fcu_A | 253 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 99.69 | |
| 1vic_A | 262 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 99.68 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.57 | |
| 2xwl_A | 223 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 99.55 | |
| 2vsh_A | 236 | TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly | 99.54 | |
| 1ezi_A | 228 | CMP-N-acetylneuraminic acid synthetase; homodimer, | 99.54 | |
| 2i5k_A | 488 | UTP--glucose-1-phosphate uridylyltransferase; LEFT | 99.54 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.53 | |
| 2dpw_A | 232 | Hypothetical protein TTHA0179; transferase, struct | 99.53 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.52 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.5 | |
| 3f1c_A | 246 | Putative 2-C-methyl-D-erythritol 4-phosphate cytid | 99.49 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.48 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.48 | |
| 2yc3_A | 228 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran | 99.46 | |
| 3rsb_A | 196 | Adenosylcobinamide-phosphate guanylyltransferase; | 99.46 | |
| 1qwj_A | 229 | Cytidine monophospho-N-acetylneuraminic acid synth | 99.45 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.44 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.44 | |
| 1vgw_A | 231 | 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; | 99.43 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.43 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.43 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.41 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.4 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.4 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.4 | |
| 1jv1_A | 505 | Glcnac1P uridyltransferase isoform 1: AGX1; nucleo | 99.39 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.37 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.37 | |
| 2wee_A | 197 | MOBA-related protein; unknown function; 1.65A {Myc | 99.36 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.36 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.35 | |
| 2waw_A | 199 | MOBA relate protein; unknown function; HET: PGE; 1 | 99.35 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.35 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.35 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.34 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.34 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.34 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.32 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.32 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.31 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.31 | |
| 1vpa_A | 234 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 99.31 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.31 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.3 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.29 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.29 | |
| 2px7_A | 236 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 99.29 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.28 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.28 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.28 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.28 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.27 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.27 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.27 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.26 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.26 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.26 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.26 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.26 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.26 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.25 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.25 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.25 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.25 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.25 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.24 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.24 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.24 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.23 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.23 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.21 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.21 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.21 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.19 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.19 | |
| 3jui_A | 182 | Translation initiation factor EIF-2B subunit EPSI; | 99.19 | |
| 2oeg_A | 505 | UTP-glucose-1-phosphate uridylyltransferase 2, put | 99.18 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.17 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.17 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.16 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.16 | |
| 3d5n_A | 197 | Q97W15_sulso; NESG, SSR125, structural genomics, P | 99.15 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.14 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.13 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.12 | |
| 1i52_A | 236 | 4-diphosphocytidyl-2-C-methylerythritol synthase; | 99.12 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.12 | |
| 3oc9_A | 405 | UDP-N-acetylglucosamine pyrophosphorylase; structu | 99.12 | |
| 1e5k_A | 201 | Molybdopterin-guanine dinucleotide biosynthesis pr | 99.12 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.09 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.09 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.09 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.06 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.06 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.06 | |
| 3q80_A | 231 | 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; | 99.05 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.05 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.05 | |
| 2e8b_A | 201 | Probable molybdopterin-guanine dinucleotide biosy | 99.05 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.03 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.03 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.03 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.02 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.02 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.0 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.0 | |
| 2yqc_A | 486 | UDP-N-acetylglucosamine pyrophosphorylase; uridine | 98.99 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 98.99 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 98.99 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 98.99 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 98.97 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 98.97 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 98.96 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 98.96 | |
| 1paq_A | 189 | Translation initiation factor EIF-2B epsilon subun | 98.96 | |
| 1w55_A | 371 | ISPD/ISPF bifunctional enzyme; biosynthetic pathwa | 98.94 | |
| 3ngw_A | 208 | Molybdopterin-guanine dinucleotide biosynthesis P | 98.94 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 98.93 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 98.93 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 98.92 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 98.91 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 98.89 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 98.89 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 98.88 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 98.83 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 98.83 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 98.81 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 98.79 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 98.76 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 98.72 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 98.7 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.66 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.61 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.59 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.53 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.35 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.34 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.23 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.23 | |
| 3r3i_A | 528 | UTP--glucose-1-phosphate uridylyltransferase; ross | 97.85 | |
| 3gue_A | 484 | UTP-glucose-1-phosphate uridylyltransferase 2; pho | 97.28 | |
| 2i5e_A | 211 | Hypothetical protein MM_2497; APC86122, methanosar | 96.69 | |
| 3ogz_A | 630 | UDP-sugar pyrophosphorylase; LEFT handed beta heli | 95.34 |
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-43 Score=385.01 Aligned_cols=363 Identities=18% Similarity=0.252 Sum_probs=246.8
Q ss_pred cCCCcEEEEEeCCCCCCCCCCCCCCCcccceeCCc-chHHHHHHHHHHCCCcEEEEEccCchHHHHHHHHhcccC--CC-
Q 007537 25 ARQPLQAILLADSFTTKFRPITLERPKVLLPLVNV-PMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWF--SQ- 100 (599)
Q Consensus 25 ~~~~l~aVILA~g~gtR~~PlT~~~PK~LLpi~n~-PlI~y~Le~L~~~gv~eV~vv~~~~~~~i~~~l~~~~w~--~~- 100 (599)
+++.|+|||||+|+|+||+|||..+||+|+||+|+ |||+|+|++|..+|+++|+|+++++.+++++|+.+ .|. ..
T Consensus 17 ~~~~~~avILAaG~gtRl~plT~~~pK~llpi~g~~pli~~~l~~l~~~g~~~i~vv~~~~~~~i~~~~~~-~~~~~~~~ 95 (451)
T 1yp2_A 17 ASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSR-AYASNMGG 95 (451)
T ss_dssp HHHHEEEEEC------CCTTTTTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCCHHHHHHHHH-HCC-----
T ss_pred cccceEEEEECCCCCCcccchhcCCcceeeEECCcceeHHHHHHHHHHCCCCEEEEEeccCHHHHHHHHhh-hhhccccc
Confidence 44569999999999999999999999999999998 99999999999999999999999988899999875 231 00
Q ss_pred --CCceEEEEe--cC-----CcCCHHHHHHHHHHhcccC----CCEEEEcCCeechhhHHHHHHHHHHhhccCCCceEEE
Q 007537 101 --PNFTVKTIE--SH-----NIISAGDALRLIYEQNVIH----GDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTM 167 (599)
Q Consensus 101 --~~~~i~~v~--~~-----~~~~~g~alr~~~~~~~i~----~dfllv~gD~v~~~~l~~ll~~h~~~~~~d~~a~mT~ 167 (599)
..-.+.++. +. ...|++++++.. ...+. ++|++++||++++.+|.++++.|++.. +.+|+
T Consensus 96 ~~~~~~v~i~~~~~~~~~~~~~~Gt~~al~~a--~~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~~-----~~~tl 168 (451)
T 1yp2_A 96 YKNEGFVEVLAAQQSPENPDWFQGTADAVRQY--LWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETD-----ADITV 168 (451)
T ss_dssp ---CCEEEEEESCSSTTSCCCCCSHHHHHHHT--HHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHTT-----CSEEE
T ss_pred ccccCcEEEecccccccccccccCcHHHHHHH--HHHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHHcC-----CcEEE
Confidence 000133332 11 147999999864 33343 349999999999999999999998753 77888
Q ss_pred EEeecCCCCCccCcccCCCceEEEEeCCCCeEEEeeccCCCC-CCceEeeHHhHhcCCceEE-EcCCccceeEeeChhhH
Q 007537 168 IIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADHS-KGTICLDKMLLAENPSISL-HNDKQDCYIDICSPEVL 245 (599)
Q Consensus 168 ~~~~~~~~~~~~~~r~g~~~~vv~~d~~~~rvl~~~ekp~~~-~~~~~i~~~~~~~~~~~~i-r~dL~d~gIyicsp~vl 245 (599)
++.+.... ...+|| ++.+|+ +++|+.|.|||... ...+.++..+|..++.... .+++.++|+|+|+++++
T Consensus 169 ~~~~~~~~---~~~~~g----~v~~d~-~~~v~~~~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l 240 (451)
T 1yp2_A 169 AALPMDEK---RATAFG----LMKIDE-EGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVM 240 (451)
T ss_dssp EEEEECHH---HHTTSE----EEEECT-TSBEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHH
T ss_pred EEEEcChh---hcccCC----EEEECC-CCCEEEEEECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHH
Confidence 87765321 234666 778885 78999999998521 1224455555543322111 24678999999999988
Q ss_pred -hhhccccchhhHHHhhhhccccccc-cCCeeEEEeccccceeeccChhHHHHHHHHhhhccccccCCCCccCCCCccee
Q 007537 246 -SLFTDNFDYQHLRRHFVKGLLLDDI-MGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKL 323 (599)
Q Consensus 246 -~lf~dnfd~q~ir~dfv~~vl~~~~-~g~~I~~~~~~~~y~~~V~s~~sY~~as~dil~rw~~p~~p~~~~~~~~~~~~ 323 (599)
+++.+.+.. ..+|...+++..+ .|.+++++.++ +||.+|+++++|.+++++++.+|. |...+... ...
T Consensus 241 ~~~l~~~~~~---~~~~~~~~l~~~i~~g~~v~~~~~~-~~w~digt~~~l~~a~~~l~~~~~----~~~~~~~~--~~~ 310 (451)
T 1yp2_A 241 LNLLRDKFPG---ANDFGSEVIPGATSLGMRVQAYLYD-GYWEDIGTIEAFYNANLGITKKPV----PDFSFYDR--SAP 310 (451)
T ss_dssp HHHHHTTCTT---CCCTTTTHHHHHHHTTCCEEEEECC-SCCEECSSHHHHHHHHHGGGCSSS----CSSCSCCS--SSC
T ss_pred HHHHHhhccc---ccchHhhHHHHHHhcCCceEEEEeC-CEEEECCCHHHHHHHHHHHhcccc----cchhccCC--CCe
Confidence 466554321 1122223333322 35799999986 799999999999999999998873 11111111 001
Q ss_pred eecceEECCCcEECCCCEECCCcEECCCCEECCCCEEeceEECCCCEECCCcEEeceEECCC------------------
Q 007537 324 ERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDN------------------ 385 (599)
Q Consensus 324 ~~~~~~~~~~~~i~~~~~I~~~~~Ig~~~~Ig~~~~I~~svIG~~~~Ig~~~~I~~s~I~~~------------------ 385 (599)
......+++++.| .++.| .++.||++|.|+. +.|.+++||++|.||++|+|.+++++.+
T Consensus 311 i~~~~~i~~~~~i-~~~~I-~~~~Ig~~~~I~~-~~i~~~~Ig~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~ 387 (451)
T 1yp2_A 311 IYTQPRYLPPSKM-LDADV-TDSVIGEGCVIKN-CKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSV 387 (451)
T ss_dssp CCCCCCCCCCEEE-EEEEE-EEEEECTTCEEEE-EEEESCEECTTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCC
T ss_pred eccCCccCCCeEE-cceEE-eCeEECCCCEEcc-eEEeccEECCCCEECCCCEEcCceEECCCCcccccccccccccCce
Confidence 1122333444444 34555 4577777777765 6667778888888888888877777777
Q ss_pred -CEECCCcEEeceEECCCCEECCCCEECCCCE
Q 007537 386 -VIIEDGCELRHVIVCDGVIMKAGAVLKPGVV 416 (599)
Q Consensus 386 -v~Ig~~~~I~~siI~~~~~Ig~~~~I~~g~v 416 (599)
+.||++|.|.+++||++|.||++++|.+++.
T Consensus 388 ~~~Ig~~~~i~~~~Ig~~~~IG~~~~i~~~~~ 419 (451)
T 1yp2_A 388 PIGIGKNCHIKRAIIDKNARIGDNVKIINKDN 419 (451)
T ss_dssp CSEECTTCEEESEEECTTCEECTTCEECCSSC
T ss_pred eEEECCCCEEeccEeCCCcEECCCCEEeCCcc
Confidence 7888888887777777777777777776543
|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* | Back alignment and structure |
|---|
| >4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* | Back alignment and structure |
|---|
| >1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* | Back alignment and structure |
|---|
| >2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} | Back alignment and structure |
|---|
| >2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... | Back alignment and structure |
|---|
| >1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* | Back alignment and structure |
|---|
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* | Back alignment and structure |
|---|
| >3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 | Back alignment and structure |
|---|
| >3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* | Back alignment and structure |
|---|
| >3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* | Back alignment and structure |
|---|
| >1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* | Back alignment and structure |
|---|
| >4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A | Back alignment and structure |
|---|
| >1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* | Back alignment and structure |
|---|
| >2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* | Back alignment and structure |
|---|
| >1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A | Back alignment and structure |
|---|
| >2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* | Back alignment and structure |
|---|
| >3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3jui_A Translation initiation factor EIF-2B subunit EPSI; heat repeat, guanine nucleotide exchange factor, disease mutation, leukodystrophy; 2.00A {Homo sapiens} SCOP: a.118.1.0 | Back alignment and structure |
|---|
| >2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >1paq_A Translation initiation factor EIF-2B epsilon subunit; heat repeat, AA motif; 2.30A {Saccharomyces cerevisiae} SCOP: a.118.1.14 | Back alignment and structure |
|---|
| >1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* | Back alignment and structure |
|---|
| >3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A | Back alignment and structure |
|---|
| >3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 | Back alignment and structure |
|---|
| >3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 599 | ||||
| d1yp2a2 | 307 | c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr | 2e-16 | |
| d1fxoa_ | 292 | c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa | 2e-15 | |
| d1mc3a_ | 291 | c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | 4e-14 | |
| d1tzfa_ | 259 | c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf | 2e-12 | |
| d1lvwa_ | 295 | c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri | 1e-10 | |
| d1g97a2 | 250 | c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate | 1e-09 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 1e-09 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 3e-08 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 2e-07 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 6e-07 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 3e-05 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 7e-05 | |
| d1jyka_ | 229 | c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer | 1e-08 | |
| d1paqa_ | 161 | a.118.1.14 (A:) Translation initiation factor eIF- | 6e-08 | |
| d2oi6a2 | 248 | c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate | 2e-07 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 6e-07 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 1e-06 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 2e-06 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 8e-04 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 7e-06 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 0.001 | |
| d1yp2a1 | 135 | b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt | 1e-05 | |
| d1yp2a1 | 135 | b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt | 1e-05 | |
| d3tdta_ | 274 | b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytra | 1e-04 | |
| d2dpwa1 | 231 | c.68.1.19 (A:1-231) Uncharacterized protein TTHA01 | 1e-04 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 0.003 |
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: glucose-1-phosphate thymidylyltransferase domain: Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain species: Potato (Solanum tuberosum) [TaxId: 4113]
Score = 77.7 bits (190), Expect = 2e-16
Identities = 44/307 (14%), Positives = 105/307 (34%), Gaps = 35/307 (11%)
Query: 20 DPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLV-NVPMINYTLAWLEAAGVAEVF 78
DPD A + + I+L T+ P+T +R K +PL N +I+ ++ + +++++
Sbjct: 5 DPD--ASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIY 62
Query: 79 VFCCAHSKQVIDYL---------ENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVI 129
V +S + +L + + G A + +
Sbjct: 63 VLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLF 122
Query: 130 ----HGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGT 185
++++++GD + M E+ + + I + P + G
Sbjct: 123 EEHTVLEYLILAGDHLYRM--------DYEKFIQAHRETDADITVAALPMDEKRATAFGL 174
Query: 186 DELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENP-SISLHNDKQDCYIDICSPEV 244
M ID + + + E + +D +L + I + S +V
Sbjct: 175 ----MKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDV 230
Query: 245 L-SLFTDNFDYQHLRRHFVKGLLLDDI-MGYKIFTHEIHSSYAARIDNYRSYDIVSKDII 302
+ +L D F + F ++ +G ++ + + Y I ++ + I
Sbjct: 231 MLNLLRDKFPGAN---DFGSEVIPGATSLGMRVQAYL-YDGYWEDIGTIEAFYNANLGIT 286
Query: 303 QRWTYPY 309
++ +
Sbjct: 287 KKPVPDF 293
|
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 | Back information, alignment and structure |
|---|
| >d1paqa_ a.118.1.14 (A:) Translation initiation factor eIF-2b epsilon {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 161 | Back information, alignment and structure |
|---|
| >d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274 | Back information, alignment and structure |
|---|
| >d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Length = 231 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 599 | |||
| d1fxoa_ | 292 | RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | 100.0 | |
| d1mc3a_ | 291 | RffH {Escherichia coli [TaxId: 562]} | 99.97 | |
| d1yp2a2 | 307 | Glucose-1-phosphate adenylyltransferase small subu | 99.97 | |
| d1lvwa_ | 295 | RmlA (RfbA) {Archaeon Methanobacterium thermoautot | 99.95 | |
| d1tzfa_ | 259 | Glucose-1-phosphate cytidylyltransferase RfbF {Sal | 99.93 | |
| d2cu2a2 | 268 | Putative mannose-1-phosphate guanylyl transferase | 99.91 | |
| d1jyka_ | 229 | CTP:phosphocholine cytidylytransferase LicC {Strep | 99.89 | |
| d1g97a2 | 250 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.8 | |
| d2oi6a2 | 248 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.72 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.42 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.29 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.28 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.27 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.23 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.23 | |
| d2dpwa1 | 231 | Uncharacterized protein TTHA0179 {Thermus thermoph | 99.2 | |
| d1vpaa_ | 221 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 99.18 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.18 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.17 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.17 | |
| d1w77a1 | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 99.15 | |
| d1i52a_ | 225 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 99.13 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.11 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.1 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.1 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.08 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.08 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.07 | |
| d1vgwa_ | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 99.07 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.06 | |
| d1e5ka_ | 188 | Molybdenum cofactor biosynthesis protein MobA {Esc | 99.02 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.01 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 98.96 | |
| d1vica_ | 255 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 98.96 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 98.96 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 98.94 | |
| d1vh1a_ | 246 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 98.92 | |
| d1w55a1 | 205 | IspD/IspF bifunctional enzyme, CDP-me synthase dom | 98.85 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 98.85 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 98.79 | |
| d1h7ea_ | 245 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 98.77 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 98.73 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 98.72 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 98.68 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 98.61 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.55 | |
| d1eyra_ | 225 | CMP acylneuraminate synthetase {Neisseria meningit | 98.55 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 98.42 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.41 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 98.39 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.37 | |
| d1qwja_ | 228 | CMP acylneuraminate synthetase {Mouse (Mus musculu | 98.2 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.14 | |
| d2icya2 | 378 | UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c | 98.06 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.03 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 97.92 | |
| d1jv1a_ | 501 | UDP-N-acetylglucosamine pyrophosphorylase {Human ( | 96.83 |
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: glucose-1-phosphate thymidylyltransferase domain: RmlA (RfbA) species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00 E-value=3e-33 Score=284.18 Aligned_cols=235 Identities=15% Similarity=0.159 Sum_probs=190.9
Q ss_pred CcEEEEEeCCCCCCCCCCCCCCCcccceeCCcchHHHHHHHHHHCCCcEEEEEcc-CchHHHHHHHHhcccCCCCCceEE
Q 007537 28 PLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCC-AHSKQVIDYLENSEWFSQPNFTVK 106 (599)
Q Consensus 28 ~l~aVILA~g~gtR~~PlT~~~PK~LLpi~n~PlI~y~Le~L~~~gv~eV~vv~~-~~~~~i~~~l~~~~w~~~~~~~i~ 106 (599)
+++|||||||+||||+|+|..+||||+||+|+|||+|+|++|..+|+++|+|+|+ ++.+++++++...+.. ++++.
T Consensus 1 k~KavILAgG~GtRl~plT~~~pKpllpi~gkPiI~~~l~~l~~~Gi~ei~ii~~~~~~~~i~~~~~~~~~~---g~~I~ 77 (292)
T d1fxoa_ 1 KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNW---GLDLQ 77 (292)
T ss_dssp CEEEEEECCCCCTTTTTHHHHSCGGGSEETTEETTHHHHHHHHHTTCCEEEEEECTTTHHHHHHHHTTSGGG---TCEEE
T ss_pred CcEEEEECCCCCCcCChhhcCCCcccCEECCEehHHHHHHHHHHCCCCEEEEEeCcCCHHHHHHHhcccccc---CeEEE
Confidence 4689999999999999999999999999999999999999999999999988877 5578899999763221 58899
Q ss_pred EEecCCcCCHHHHHHHHHHhcccCCC--EEEEcCCeechhhHHHHHHHHHHhhccCCCceEEEEEeecCCCCCccCcccC
Q 007537 107 TIESHNIISAGDALRLIYEQNVIHGD--FVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLG 184 (599)
Q Consensus 107 ~v~~~~~~~~g~alr~~~~~~~i~~d--fllv~gD~v~~~~l~~ll~~h~~~~~~d~~a~mT~~~~~~~~~~~~~~~r~g 184 (599)
++.++.+.|+|+|+..+ +.++.++ |+++++|++++.+|.++++.|.++. +.+|+++.++. ++.+||
T Consensus 78 y~~q~~~~Gta~ai~~a--~~~i~~~~~~lil~dD~~~~~dl~~ll~~h~~~~-----~~~~i~~~~V~-----~p~~yG 145 (292)
T d1fxoa_ 78 YAVQPSPDGLAQAFLIG--ESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQ-----TGASVFAYHVL-----DPERYG 145 (292)
T ss_dssp EEECSSCCCGGGHHHHT--HHHHTTSEEEEEETTEEEECTTHHHHHHHHHTCC-----SSEEEEEEECS-----CGGGSE
T ss_pred EccCCCCCcHHHHHHhh--hhhcCCCceEEEEccccccCcCHHHHHHHHHhCC-----CCcEEEEEECC-----CHHHCe
Confidence 99999999999999954 6778765 6778889999999999999998864 66788888875 456899
Q ss_pred CCceEEEEeCCCCeEEEeeccCCCCCCceEeeHHhHhcCCceEEEcCCccceeEeeChhhHhhhccccchhhHHHhhhhc
Q 007537 185 TDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKG 264 (599)
Q Consensus 185 ~~~~vv~~d~~~~rvl~~~ekp~~~~~~~~i~~~~~~~~~~~~ir~dL~d~gIyicsp~vl~lf~dnfd~q~ir~dfv~~ 264 (599)
|+.+|. +++++.+.|||..+ .++|..+|+|++++++++++..-..-.. ....+.+
T Consensus 146 ----V~~~d~-~~ki~~~~EKP~~p-------------------~Snla~~G~Y~f~~~~~~~~~~l~~s~r-gE~eitD 200 (292)
T d1fxoa_ 146 ----VVEFDQ-GGKAISLEEKPLEP-------------------KSNYAVTGLYFYDQQVVDIARDLKPSPR-GELEITD 200 (292)
T ss_dssp ----EEEECT-TSCEEEEEESCSSC-------------------SSSEEEEEEEEECTTHHHHHHHCCCCTT-SSCCHHH
T ss_pred ----EEEEcC-CCCEeEEEECCCCC-------------------CCCcEEEEEEEEChHHHHHHHhCCCCCC-CchhhHH
Confidence 888986 78999999998632 2678899999999999987754321110 1223444
Q ss_pred cccccccCCeeEEEecccc-ceeeccChhHHHHHHHHhh
Q 007537 265 LLLDDIMGYKIFTHEIHSS-YAARIDNYRSYDIVSKDII 302 (599)
Q Consensus 265 vl~~~~~g~~I~~~~~~~~-y~~~V~s~~sY~~as~dil 302 (599)
+++..+..+++.++.+..+ +|.+++|+.+|.++++.+.
T Consensus 201 ~~~~~l~~~~~~~~~~~~~~~W~D~Gt~~~l~~a~~~v~ 239 (292)
T d1fxoa_ 201 VNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIA 239 (292)
T ss_dssp HHHHHHHTTCEEEEECCTTSEEEECCSHHHHHHHHHHHH
T ss_pred HHHHHHHcCCeEEEEeCCCCEEEeCCCHHHHHHHHHHHH
Confidence 4444455667777777666 5999999999999997664
|
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} | Back information, alignment and structure |
|---|