Citrus Sinensis ID: 007582


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------
MGDKVENIKQKGGFRACTFVFVFSALENMGFIANGISMVLYFKNEMHFDLAGASNTLTNFFGSTFLLCLVGGFISDTFLSRFATCLIFGTLEVLALVMLTIQAYSKNLHPPDCGKSSCLKGAIAAYFYGSLYLYSFGCGGNRGTLPAFGAGQFDENDPKGAKALASYFNFYLLATTVAAVIGVTGIVYVFTEKSWWLGFLVSSVANFIGLIALAAGKCLYRIQQPGESPLVRVAQVLVVAIKNRKLSLPDNPEELYEINEKERASTWERIPHANQFRCLDKAAIMPKDSAVAAPWRVCTVTQVEEVKILTRMMPILASTILMNTCLAQLQTFSITQGAAMDPHLGSIKVPTSSIPVIPLLFMSILLPLYEFFFVPFARKITGHPSGITQLQRVGIGLVLSAVSMTVAGLVEVIRRNAFNETPPKQISLFWLSFQYCIFGIADMFTFIGLLEFFYKEAPAGMKTLASSFTYLSLSFGYFLSSAFVDIINAVTKRITPSKQGWLHGKDINKNNVNLFYWFLAIVSVLNLVLYLYAAAWYKYKPENCSDIKPKPLMDPSAKEEKIDQDDGKAKQYGAASSDDGIIGKEKEFIHDEVKSQE
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccc
**********KGGFRACTFVFVFSALENMGFIANGISMVLYFKNEMHFDLAGASNTLTNFFGSTFLLCLVGGFISDTFLSRFATCLIFGTLEVLALVMLTIQAYSKNLHPPDCGKSSCLKGAIAAYFYGSLYLYSFGCGGNRGTLPAFGAGQFDENDPKGAKALASYFNFYLLATTVAAVIGVTGIVYVFTEKSWWLGFLVSSVANFIGLIALAAGKCLYRIQQPGESPLVRVAQVLVVAIKNRKLSLPDNPEELYEI******STWERIPHANQFRCLDKAAIMPKDSAVAAPWRVCTVTQVEEVKILTRMMPILASTILMNTCLAQLQTFSITQGAAMDPHLGSIKVPTSSIPVIPLLFMSILLPLYEFFFVPFARKITGHPSGITQLQRVGIGLVLSAVSMTVAGLVEVIRRNAFNETPPKQISLFWLSFQYCIFGIADMFTFIGLLEFFYKEAPAGMKTLASSFTYLSLSFGYFLSSAFVDIINAVTKRITPSKQGWLHGKDINKNNVNLFYWFLAIVSVLNLVLYLYAAAWYKYKPE*******************************************************
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDKVENIKQKGGFRACTFVFVFSALENMGFIANGISMVLYFKNEMHFDLAGASNTLTNFFGSTFLLCLVGGFISDTFLSRFATCLIFGTLEVLALVMLTIQAYSKNLHPPDCGKSSCLKGAIAAYFYGSLYLYSFGCGGNRGTLPAFGAGQFDENDPKGAKALASYFNFYLLATTVAAVIGVTGIVYVFTEKSWWLGFLVSSVANFIGLIALAAGKCLYRIQQPGESPLVRVAQVLVVAIKNRKLSLPDNPEELYEINEKERASTWERIPHANQFRCLDKAAIMPKDSAVAAPWRVCTVTQVEEVKILTRMMPILASTILMNTCLAQLQTFSITQGAAMDPHLGSIKVPTSSIPVIPLLFMSILLPLYEFFFVPFARKITGHPSGITQLQRVGIGLVLSAVSMTVAGLVEVIRRNAFNETPPKQISLFWLSFQYCIFGIADMFTFIGLLEFFYKEAPAGMKTLASSFTYLSLSFGYFLSSAFVDIINAVTKRITPSKQGWLHGKDINKNNVNLFYWFLAIVSVLNLVLYLYAAAWYKYKPENCSDIKPKPLMDPSAKEEKIDQDDGKAKQYGAASSDDGIIGKEKEFIHDEVKSQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable peptide/nitrate transporter At1g59740 probableQ93VV5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4APS, chain A
Confidence level:very confident
Coverage over the Query: 13-103,123-263,275-285,309-489,510-518
View the alignment between query and template
View the model in PyMOL
Template: 2XUT, chain A
Confidence level:confident
Coverage over the Query: 16-103,122-224,245-286,299-372,388-516
View the alignment between query and template
View the model in PyMOL
Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 33-215,248-381,393-413,424-550
View the alignment between query and template
View the model in PyMOL