Citrus Sinensis ID: 007619

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-----
MVLDSIMENANEMSSSLSFASSSYLSNGSTNHPASPELCSSLDNLSLSKLSSNLEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLALSSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSGNLKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDASLLENGTPEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGLSSSSSSSSSPKEGVKCKGRKR
ccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEcccEEEEEHHHHHHccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHcccccHHHHHccccccccccccccHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
cccccccccccccccccccccccEEccccccccccccccccHcHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHcHHHHHHHHcccccccccccccccccccHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccccccccccccccccccc
MVLDSIMENANEMSSSLSFAsssylsngstnhpaspelcssldnlslsKLSSNLEKLLLDAehdytdadivveGKSVAVHRCILSARSQFFHELFkkgndndgsavsegkpkyLMTElvpygkvgYEAFNVILYYFYtgklkpspsevstcvddacahdacppAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVrsnlddvclekelpdevsGEIKSLRVksdeeceaniaevdpMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLAdlnlknarghtVLHVAARRKEPAVLVTLLSkgacasettsdgQTAVAICRRMTRRKDYIEATKQgqetnkdrLCIDVLEREMRRnsmsgnlalssevmaDDFQMKLNYLENRVAFARLLFPSEARVAMHIAdadatnfytglsaskskgssgnlkevdlnetpSMQAKRLQLRLQALLKTVEtgrryfphcsdvvdkfldcdwsdasllengtpEEQRLKRARFMELKEDVQKAFYKDMaeknrsglssssssssspkegvkckgrkr
MVLDSIMENANEMSSSLSFASSSYLSNGSTNHPASPELCSSLDNLSLSKLSSNLEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKkgndndgsavsegkpKYLMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLddvclekelpdevsgeikslrvksdeeceaniaevdpmhakRVRRIHKALDSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSkgacasettsdgqtaVAICRRMTRRKDYIeatkqgqetnkdrlcIDVLEREMRRnsmsgnlalsseVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLsaskskgssgnlkevdlnETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDAsllengtpeeqRLKRARFMELKEDVQKAFYKDMAEKnrsglssssssssspkegvkckgrkr
MVLDSIMENANEMssslsfasssylsngsTNHPASPelcssldnlslsklssnlekllldAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTcvddacahdacPPAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKAldsddvellkllldesNVTlddayalhyaaayCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLALSSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTglsaskskgssgnlkEVDLNETPSMqakrlqlrlqallkTVETGRRYFPHCSDVVDKFLDCDWSDASLLENGTPEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGLsssssssssPKEGVKCKGRKR
*****************************************************LEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKK*************PKYLMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKE*******************************AKRVRRIHKALDSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYI************RLCIDVL*****************EVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTG****************************LQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDASLL***********************************************************
************************************************KLSSNLEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELF********************TELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLALSSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYT******************LNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDA*****************FMELKEDVQKAFYK*******************************
**********************************SPELCSSLDNLSLSKLSSNLEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVPYGKVGYEAFNVILYYFYTGKLKP********VDDACAHDACPPAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGAC*********TAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLALSSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSAS*********KEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDASLLENGTPEEQRLKRARFMELKEDVQKAFYKDMAE***************************
*************************************LCSSLDNLSLSKLSSNLEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKG************PKYLMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLALSSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKS*GSSGNLKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDASLLENGTPEEQRLKRARFMELKEDVQKAFYKD******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLDSIMENANEMSSSLSFASSSYLSNGSTNHPASPELCSSLDNLSLSKLSSNLEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLALSSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSGNLKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDASLLENGTPEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGLSSSSSSSSSPKEGVKCKGRKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query595 2.2.26 [Sep-21-2011]
Q8L746586 Regulatory protein NPR3 O yes no 0.868 0.882 0.538 1e-161
Q5ICL9574 Regulatory protein NPR4 O no no 0.873 0.905 0.541 1e-157
P93002593 Regulatory protein NPR1 O no no 0.910 0.913 0.381 1e-100
Q9SZI3600 Regulatory protein NPR2 O no no 0.946 0.938 0.372 8e-97
Q9M1I7467 Regulatory protein NPR6 O no no 0.601 0.766 0.321 2e-47
Q9ZVC2491 Regulatory protein NPR5 O no no 0.601 0.729 0.324 2e-46
P16157 1881 Ankyrin-1 OS=Homo sapiens yes no 0.132 0.041 0.380 8e-06
Q96Q07612 BTB/POZ domain-containing no no 0.163 0.158 0.327 1e-05
Q8C726612 BTB/POZ domain-containing yes no 0.163 0.158 0.327 1e-05
Q5PQR3612 BTB/POZ domain-containing yes no 0.163 0.158 0.327 1e-05
>sp|Q8L746|NPR3_ARATH Regulatory protein NPR3 OS=Arabidopsis thaliana GN=NPR3 PE=1 SV=1 Back     alignment and function desciption
 Score =  568 bits (1463), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 286/531 (53%), Positives = 385/531 (72%), Gaps = 14/531 (2%)

Query: 45  LSLSKLSSNLEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGS 104
           +SL+KLSSNLE+LL +++ DY+DA+I+V+G  V VHRCIL+ARS+FF +LFKK    +  
Sbjct: 39  VSLTKLSSNLEQLLSNSDCDYSDAEIIVDGVPVGVHRCILAARSKFFQDLFKK----EKK 94

Query: 105 AVSEGKPKYLMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPA 164
                KPKY + E++PYG V +EAF   L Y YTG+LKP P EVSTCVD  C+HD C PA
Sbjct: 95  ISKTEKPKYQLREMLPYGAVAHEAFLYFLSYIYTGRLKPFPLEVSTCVDPVCSHDCCRPA 154

Query: 165 INYAIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQ 224
           I++ ++LMYAS+  Q+ ELV  FQRRL NFVEK LVE+V+PIL+ AF+C+L QL   C++
Sbjct: 155 IDFVVQLMYASSVLQVPELVSSFQRRLCNFVEKTLVENVLPILMVAFNCKLTQLLDQCIE 214

Query: 225 RVVRSNLDDVCLEKELPDEVSGEIKSLRVKS--DEECEANIAEVDPMHAKRVRRIHKALD 282
           RV RS+L   C+EKE+P EV+ +IK LR+ S  DEE    I+E      +R+ +I KALD
Sbjct: 215 RVARSDLYRFCIEKEVPPEVAEKIKQLRLISPQDEETSPKISE---KLLERIGKILKALD 271

Query: 283 SDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHV 342
           SDDVEL+KLLL ES++TLD A  LHY+  Y +PKV  E+L + + D+N +N+RG+TVLH 
Sbjct: 272 SDDVELVKLLLTESDITLDQANGLHYSVVYSDPKVVAEILALDMGDVNYRNSRGYTVLHF 331

Query: 343 AARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCI 402
           AA R+EP+++++L+ KGA ASE TSDG++AV I RR+T  KDY   T +G+E++K RLCI
Sbjct: 332 AAMRREPSIIISLIDKGANASEFTSDGRSAVNILRRLTNPKDYHTKTAKGRESSKARLCI 391

Query: 403 DVLEREMRRNSMSGNLALSSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADA 462
           D+LERE+R+N M  +  + S  M +D QM+L YLE RV  A+L FP+EA+VAM I + + 
Sbjct: 392 DILEREIRKNPMVLDTPMCSISMPEDLQMRLLYLEKRVGLAQLFFPTEAKVAMDIGNVEG 451

Query: 463 TNFYTGLSASKSKGSSGNLKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVV 522
           T+ +TGLS   S G +GNL +VDLNETP MQ +RL  R+ AL+KTVETGRR+FP+ S+V+
Sbjct: 452 TSEFTGLSPP-SSGLTGNLSQVDLNETPHMQTQRLLTRMVALMKTVETGRRFFPYGSEVL 510

Query: 523 DKFL----DCDWSDASLLENGTPEEQRLKRARFMELKEDVQKAFYKDMAEK 569
           DK++    D D  D    E G+  E+RLKR R+ ELK+DVQKA+ KD   K
Sbjct: 511 DKYMAEYIDDDILDDFHFEKGSTHERRLKRMRYRELKDDVQKAYSKDKESK 561
May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Involved in the regulation of basal defense responses against pathogens.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5ICL9|NPR4_ARATH Regulatory protein NPR4 OS=Arabidopsis thaliana GN=NPR4 PE=1 SV=1 Back     alignment and function description
>sp|P93002|NPR1_ARATH Regulatory protein NPR1 OS=Arabidopsis thaliana GN=NPR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZI3|NPR2_ARATH Regulatory protein NPR2 OS=Arabidopsis thaliana GN=NPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q9M1I7|NPR6_ARATH Regulatory protein NPR6 OS=Arabidopsis thaliana GN=NPR6 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVC2|NPR5_ARATH Regulatory protein NPR5 OS=Arabidopsis thaliana GN=NPR5 PE=1 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q96Q07|BTBD9_HUMAN BTB/POZ domain-containing protein 9 OS=Homo sapiens GN=BTBD9 PE=2 SV=2 Back     alignment and function description
>sp|Q8C726|BTBD9_MOUSE BTB/POZ domain-containing protein 9 OS=Mus musculus GN=Btbd9 PE=2 SV=1 Back     alignment and function description
>sp|Q5PQR3|BTBD9_RAT BTB/POZ domain-containing protein 9 OS=Rattus norvegicus GN=Btbd9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
224062625597 NPR1/NIM1-like regulatory protein [Popul 0.984 0.981 0.706 0.0
356501441590 PREDICTED: regulatory protein NPR3-like 0.905 0.913 0.653 0.0
224085403585 NPR1/NIM1-like regulatory protein [Popul 0.936 0.952 0.664 0.0
449525948585 PREDICTED: regulatory protein NPR3-like 0.912 0.928 0.673 0.0
255559053590 Regulatory protein NPR1, putative [Ricin 0.939 0.947 0.649 0.0
351726319590 NPR1-1 protein [Glycine max] gi|21326848 0.905 0.913 0.653 0.0
449460026585 PREDICTED: regulatory protein NPR3-like 0.912 0.928 0.668 0.0
332656172587 regulatory protein NPR2 [Populus deltoid 0.927 0.940 0.654 0.0
351726790590 NPR1-2 protein [Glycine max] gi|21326851 0.899 0.906 0.645 0.0
224136524589 NPR1/NIM1-like regulatory protein [Popul 0.895 0.904 0.651 0.0
>gi|224062625|ref|XP_002300863.1| NPR1/NIM1-like regulatory protein [Populus trichocarpa] gi|222842589|gb|EEE80136.1| NPR1/NIM1-like regulatory protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/599 (70%), Positives = 501/599 (83%), Gaps = 13/599 (2%)

Query: 7   MENANEMSSSLSFASSSYLSNGSTNHPAS----PELCSSLDNLSLSKLSSNLEKLLLDAE 62
           ME+ANEM+SSLSFASSSYLSNGS+ H  S    PE   +L+NLSL+KLS NLE+LLLD E
Sbjct: 1   MESANEMTSSLSFASSSYLSNGSSIHHVSASNVPEPGVNLENLSLNKLSGNLERLLLDKE 60

Query: 63  HDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVPYG 122
           +DY+DA+I VEG  V VHRC+L+ARSQFFHELFKKGN+N   + +  KP+YLM++LVPYG
Sbjct: 61  YDYSDAEIFVEGTPVGVHRCVLAARSQFFHELFKKGNNN---STNGDKPRYLMSDLVPYG 117

Query: 123 KVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKE 182
            VGYEAF+V L+Y YTGKLKPSP EVS CVDDACAHD C PAINY +ELM ASA FQMKE
Sbjct: 118 GVGYEAFHVFLHYLYTGKLKPSPPEVSRCVDDACAHDVCRPAINYVVELMCASATFQMKE 177

Query: 183 LVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPD 242
           LVLLFQRRLLNF+EKALVEDVIPIL+AAFH QL+QL SHC++R+VRS+LD  C++KELPD
Sbjct: 178 LVLLFQRRLLNFIEKALVEDVIPILMAAFHYQLDQLLSHCIERLVRSDLDSTCIDKELPD 237

Query: 243 EVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDD 302
           E+S +IK LR KS  E E+++ EVDP+  K  RRIHKALDSDDVEL++LLL ESN+TLDD
Sbjct: 238 EISSKIKLLRKKSLPEAESSVEEVDPILEKSFRRIHKALDSDDVELVELLLSESNLTLDD 297

Query: 303 AYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACA 362
           AYALHYA AYC+PK+ KEVL++G ADLNL+N+RG++VLHVAARRKEP++++ LL++GA A
Sbjct: 298 AYALHYAVAYCDPKIVKEVLSLGSADLNLRNSRGYSVLHVAARRKEPSIIMALLTRGASA 357

Query: 363 SETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREM-RRNSMSGNLALS 421
           SETT DGQ AVAICRR+TR KDY E TKQGQE+NKDR+CIDVLE +M RRNSMS N++  
Sbjct: 358 SETTLDGQNAVAICRRLTRPKDYNENTKQGQESNKDRICIDVLETDMRRRNSMSANVSTL 417

Query: 422 SEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSGNL 481
           S  +ADD  MKL+YLENRVAFARLLFP+EAR+AM  A+A++T+ YTGL ASKSKGSSG+L
Sbjct: 418 SPSVADDLSMKLDYLENRVAFARLLFPAEARLAMDSANANSTSMYTGLLASKSKGSSGDL 477

Query: 482 KEVDLNETPSMQAKRLQLRLQALLKT-----VETGRRYFPHCSDVVDKFLDCDWSDASLL 536
           +EVDLNETP++QAKRLQ RLQAL KT     +ETGR YFPHCS VVDKFLD D  DA  L
Sbjct: 478 REVDLNETPTVQAKRLQSRLQALHKTGTIYCMETGRHYFPHCSKVVDKFLDDDMPDALFL 537

Query: 537 ENGTPEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGLSSSSSSSSSPKEGVKCKGRKR 595
           + GTPEEQ+ K+ RF ELK+DVQKAFYKDM   NRS  SSSSSSSSSPK GV  K R++
Sbjct: 538 DKGTPEEQKTKKMRFTELKDDVQKAFYKDMENNNRSARSSSSSSSSSPKSGVTYKARRK 596

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356501441|ref|XP_003519533.1| PREDICTED: regulatory protein NPR3-like [Glycine max] Back     alignment and taxonomy information
>gi|224085403|ref|XP_002307566.1| NPR1/NIM1-like regulatory protein [Populus trichocarpa] gi|222857015|gb|EEE94562.1| NPR1/NIM1-like regulatory protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449525948|ref|XP_004169978.1| PREDICTED: regulatory protein NPR3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255559053|ref|XP_002520549.1| Regulatory protein NPR1, putative [Ricinus communis] gi|223540263|gb|EEF41835.1| Regulatory protein NPR1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351726319|ref|NP_001238658.1| NPR1-1 protein [Glycine max] gi|213268485|gb|ACJ45013.1| NPR1-1 protein [Glycine max] Back     alignment and taxonomy information
>gi|449460026|ref|XP_004147747.1| PREDICTED: regulatory protein NPR3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|332656172|gb|AEE81755.1| regulatory protein NPR2 [Populus deltoides] Back     alignment and taxonomy information
>gi|351726790|ref|NP_001238674.1| NPR1-2 protein [Glycine max] gi|213268511|gb|ACJ45015.1| NPR1-2 protein [Glycine max] Back     alignment and taxonomy information
>gi|224136524|ref|XP_002322351.1| NPR1/NIM1-like regulatory protein [Populus trichocarpa] gi|222869347|gb|EEF06478.1| NPR1/NIM1-like regulatory protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
TAIR|locus:2133925574 NPR4 "NPR1-like protein 4" [Ar 0.833 0.864 0.464 9.7e-112
TAIR|locus:2153192586 NPR3 "AT5G45110" [Arabidopsis 0.836 0.849 0.453 1.1e-108
TAIR|locus:2014200593 NPR1 "AT1G64280" [Arabidopsis 0.868 0.871 0.329 1.6e-70
TAIR|locus:2120800600 AT4G26120 "AT4G26120" [Arabido 0.830 0.823 0.325 4.5e-66
TAIR|locus:2080595467 BOP1 "BLADE ON PETIOLE 1" [Ara 0.635 0.809 0.265 3.7e-32
TAIR|locus:2040292491 BOP2 "BLADE ON PETIOLE2" [Arab 0.569 0.690 0.272 3.6e-27
TAIR|locus:2133925 NPR4 "NPR1-like protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1103 (393.3 bits), Expect = 9.7e-112, P = 9.7e-112
 Identities = 239/515 (46%), Positives = 323/515 (62%)

Query:    64 DYTDADIVVEGKS--VAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVPY 121
             DYTDA+I++E ++  V+VHRC+L+ARS+FF +LFKK  D+     SE KPKY M +L+PY
Sbjct:    52 DYTDAEIIIEEEANPVSVHRCVLAARSKFFLDLFKKDKDS-----SEKKPKYQMKDLLPY 106

Query:   122 GKVGYEAFNVILYYFYTGKLKPSPSEVSTXXXXXXXXXXXPPAINYAIELMYASAAFQMK 181
             G VG EAF   L Y YTG+LKP P EVST            PAI++A+ELMYAS  FQ+ 
Sbjct:   107 GNVGREAFLHFLSYIYTGRLKPFPIEVSTCVDSVCAHDSCKPAIDFAVELMYASFVFQIP 166

Query:   182 ELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELP 241
             +LV  FQR+L N+VEK+LVE+V+PIL+ AFHC L QL   C++RV RS+LD  C+EKELP
Sbjct:   167 DLVSSFQRKLRNYVEKSLVENVLPILLVAFHCDLTQLLDQCIERVARSDLDRFCIEKELP 226

Query:   242 DEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKAXXXXXXXXXXXXXXXXNVTXX 301
              EV  +IK LRVKS      NI EV+    +R  ++ KA                ++T  
Sbjct:   227 LEVLEKIKQLRVKS-----VNIPEVEDKSIERTGKVLKALDSDDVELVKLLLTESDITLD 281

Query:   302 XXXXXXXXXXXCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGAC 361
                         +PKV  +VL++ +AD+N +N+RG+TVLH+AA R+EP +++ L+ KGA 
Sbjct:   282 QANGLHYAVAYSDPKVVTQVLDLDMADVNFRNSRGYTVLHIAAMRREPTIIIPLIQKGAN 341

Query:   362 ASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSM-SGNLAL 420
             AS+ T DG++AV ICRR+TR KDY   T + +E +K RLCID+LERE+RRN + SG+   
Sbjct:   342 ASDFTFDGRSAVNICRRLTRPKDYHTKTSR-KEPSKYRLCIDILEREIRRNPLVSGDTPT 400

Query:   421 SSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTXXXXXX-XXXXXX 479
              S  M +D QM+L YLE RV  A+L FP+EA VAM +A+ + T+  T             
Sbjct:   401 CSHSMPEDLQMRLLYLEKRVGLAQLFFPAEANVAMDVANVEGTSECTGLLTPPPSNDTTE 460

Query:   480 XXXEVDLNETPSMXXXXXXXXXXXXXXTVETGRRYFPHCSDVVDKFLDC----DWSDASL 535
                +VDLNETP +              TVETGRRYFP C +V+DK++D     +  D S 
Sbjct:   461 NLGKVDLNETPYVQTKRMLTRMKALMKTVETGRRYFPSCYEVLDKYMDQYMDEEIPDMSY 520

Query:   536 LENGTPEEQRLKRARFMELKEDVQKAFYKDMAEKN 570
              E GT +E+R KR R+ ELK DV+KA+ KD   ++
Sbjct:   521 PEKGTVKERRQKRMRYNELKNDVKKAYSKDKVARS 555
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009617 "response to bacterium" evidence=IEP;RCA;IMP
GO:0009620 "response to fungus" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=IMP
GO:0050832 "defense response to fungus" evidence=IMP
GO:2000022 "regulation of jasmonic acid mediated signaling pathway" evidence=IMP
GO:2000031 "regulation of salicylic acid mediated signaling pathway" evidence=IMP
GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IMP
GO:0009817 "defense response to fungus, incompatible interaction" evidence=IMP
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=IGI;RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0080185 "effector dependent induction by symbiont of host immune response" evidence=IGI
GO:1901149 "salicylic acid binding" evidence=IDA
TAIR|locus:2153192 NPR3 "AT5G45110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014200 NPR1 "AT1G64280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120800 AT4G26120 "AT4G26120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080595 BOP1 "BLADE ON PETIOLE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040292 BOP2 "BLADE ON PETIOLE2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L746NPR3_ARATHNo assigned EC number0.53860.86890.8822yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
pfam12313203 pfam12313, NPR1_like_C, NPR1/NIM1 like defence pro 1e-110
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-14
pfam1190048 pfam11900, DUF3420, Domain of unknown function (DU 1e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-13
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 7e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-10
pfam00651101 pfam00651, BTB, BTB/POZ domain 5e-10
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.001
>gnl|CDD|204877 pfam12313, NPR1_like_C, NPR1/NIM1 like defence protein C terminal Back     alignment and domain information 
 Score =  327 bits (841), Expect = e-110
 Identities = 134/205 (65%), Positives = 163/205 (79%), Gaps = 2/205 (0%)

Query: 377 RRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLALSSEVMADDFQMKLNYL 436
           +R+TR KDY   T+QG+E+NKDRLCI++LE+EMRRN M G+ ++SS + ADD +M+L YL
Sbjct: 1   KRLTRPKDYNTKTEQGKESNKDRLCIEILEQEMRRNPMPGDASVSSALAADDLRMRLLYL 60

Query: 437 ENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSGNLKEVDLNETPSMQAKR 496
           ENRVA ARLLFP+EA++AM IA AD T+ +TGLSASK  GS GNL EVDLNETP +Q +R
Sbjct: 61  ENRVALARLLFPAEAKLAMDIAQADGTSEFTGLSASK--GSGGNLTEVDLNETPFVQKER 118

Query: 497 LQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDASLLENGTPEEQRLKRARFMELKE 556
              RL+AL KTVE GRR+FP CS+V+DK +D D  D + LE GTPEEQ+ KR RFMELKE
Sbjct: 119 HLSRLKALSKTVELGRRFFPRCSEVLDKIMDDDLPDLAYLEKGTPEEQKQKRMRFMELKE 178

Query: 557 DVQKAFYKDMAEKNRSGLSSSSSSS 581
           DVQKAF KD  E NRS LSSSSSS+
Sbjct: 179 DVQKAFSKDKEELNRSSLSSSSSST 203

This family of proteins is found in eukaryotes. Proteins in this family are typically between 251 and 588 amino acids in length. The family is found in association with pfam00023, pfam00651. There are two conserved sequence motifs: LENRV and DLN. NPR1 (NIM1) is a defence protein in many plant species. Length = 203
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|192869 pfam11900, DUF3420, Domain of unknown function (DUF3420) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 595
PF12313207 NPR1_like_C: NPR1/NIM1 like defence protein C term 100.0
PHA02791284 ankyrin-like protein; Provisional 99.96
PHA02946446 ankyin-like protein; Provisional 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
PHA03095471 ankyrin-like protein; Provisional 99.95
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.95
PHA02791284 ankyrin-like protein; Provisional 99.95
PHA02875413 ankyrin repeat protein; Provisional 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
PHA02878477 ankyrin repeat protein; Provisional 99.94
PHA02946446 ankyin-like protein; Provisional 99.94
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.93
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.93
PHA02874434 ankyrin repeat protein; Provisional 99.93
PHA03095471 ankyrin-like protein; Provisional 99.93
PHA02874434 ankyrin repeat protein; Provisional 99.93
PHA02798489 ankyrin-like protein; Provisional 99.93
PHA02876682 ankyrin repeat protein; Provisional 99.93
PHA02989494 ankyrin repeat protein; Provisional 99.93
PHA02875413 ankyrin repeat protein; Provisional 99.93
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.92
KOG0510 929 consensus Ankyrin repeat protein [General function 99.92
PHA02876682 ankyrin repeat protein; Provisional 99.92
PHA02989494 ankyrin repeat protein; Provisional 99.92
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.91
PHA02795437 ankyrin-like protein; Provisional 99.9
PHA02878477 ankyrin repeat protein; Provisional 99.9
PHA02798489 ankyrin-like protein; Provisional 99.9
PHA02859209 ankyrin repeat protein; Provisional 99.89
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.89
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.88
PHA02917 661 ankyrin-like protein; Provisional 99.88
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.88
PHA02917 661 ankyrin-like protein; Provisional 99.87
PHA02730672 ankyrin-like protein; Provisional 99.86
KOG0508 615 consensus Ankyrin repeat protein [General function 99.86
PHA02859209 ankyrin repeat protein; Provisional 99.86
PHA02730672 ankyrin-like protein; Provisional 99.84
PHA02743166 Viral ankyrin protein; Provisional 99.84
PHA02795437 ankyrin-like protein; Provisional 99.83
PHA02741169 hypothetical protein; Provisional 99.83
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.83
PLN03192823 Voltage-dependent potassium channel; Provisional 99.83
PHA02713557 hypothetical protein; Provisional 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.82
KOG0514452 consensus Ankyrin repeat protein [General function 99.82
KOG4350620 consensus Uncharacterized conserved protein, conta 99.81
KOG0508 615 consensus Ankyrin repeat protein [General function 99.81
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.81
PHA02792631 ankyrin-like protein; Provisional 99.79
KOG4591280 consensus Uncharacterized conserved protein, conta 99.79
PHA02884300 ankyrin repeat protein; Provisional 99.79
PHA02743166 Viral ankyrin protein; Provisional 99.79
PLN03192823 Voltage-dependent potassium channel; Provisional 99.78
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.77
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.77
KOG0514452 consensus Ankyrin repeat protein [General function 99.76
PHA02790480 Kelch-like protein; Provisional 99.75
PHA02792631 ankyrin-like protein; Provisional 99.75
PHA03098534 kelch-like protein; Provisional 99.74
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.73
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.73
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.72
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.72
PHA02884300 ankyrin repeat protein; Provisional 99.7
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.7
PHA02736154 Viral ankyrin protein; Provisional 99.7
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.7
PHA02741169 hypothetical protein; Provisional 99.7
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.67
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.66
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.63
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.62
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.62
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.61
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.6
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.59
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.58
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.53
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.5
KOG2075521 consensus Topoisomerase TOP1-interacting protein B 99.49
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.49
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.49
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.46
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.45
KOG07831267 consensus Uncharacterized conserved protein, conta 99.35
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.34
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.34
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.33
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.31
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.29
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.27
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.25
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.24
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.16
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.14
KOG4682488 consensus Uncharacterized conserved protein, conta 99.11
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.09
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.02
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.72
PF1360630 Ank_3: Ankyrin repeat 98.68
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.64
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.64
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.62
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.52
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.46
KOG0522 560 consensus Ankyrin repeat protein [General function 98.45
PF1360630 Ank_3: Ankyrin repeat 98.38
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.37
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.36
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.33
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.31
KOG0522 560 consensus Ankyrin repeat protein [General function 98.28
KOG2838401 consensus Uncharacterized conserved protein, conta 98.26
KOG0520975 consensus Uncharacterized conserved protein, conta 98.2
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.13
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.11
KOG2384223 consensus Major histocompatibility complex protein 97.99
KOG2838401 consensus Uncharacterized conserved protein, conta 97.99
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.79
KOG0511 516 consensus Ankyrin repeat protein [General function 97.72
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.63
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.33
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.31
KOG2384223 consensus Major histocompatibility complex protein 97.1
KOG0511 516 consensus Ankyrin repeat protein [General function 97.08
KOG2716230 consensus Polymerase delta-interacting protein PDI 96.98
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.72
KOG2505591 consensus Ankyrin repeat protein [General function 96.33
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 96.3
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.53
KOG2505591 consensus Ankyrin repeat protein [General function 95.3
KOG3473112 consensus RNA polymerase II transcription elongati 95.07
KOG2714465 consensus SETA binding protein SB1 and related pro 94.61
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 94.53
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.43
PF12313207 NPR1_like_C: NPR1/NIM1 like defence protein C term 91.17
KOG1665302 consensus AFH1-interacting protein FIP2, contains 90.4
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 88.05
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 87.12
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 85.82
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 84.97
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 84.38
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 83.67
KOG2715210 consensus Uncharacterized conserved protein, conta 80.92
>PF12313 NPR1_like_C: NPR1/NIM1 like defence protein C terminal; InterPro: IPR021094 This entry represents the NPR1/NIM1 like defence protein, which is found in many plant species [] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-71  Score=504.05  Aligned_cols=201  Identities=66%  Similarity=0.928  Sum_probs=193.5

Q ss_pred             cCChhhHHHHHHcCCCchhhcccHHHHHHHH-hccccCCCcccchhhhcchhHHHHHhhhhhhhHHhhcCcchhhHHHhh
Q 007619          379 MTRRKDYIEATKQGQETNKDRLCIDVLEREM-RRNSMSGNLALSSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHI  457 (595)
Q Consensus       379 ~~~~~~v~~l~~~g~~~~~~~~~~~~le~~~-~~~p~~~~~~~~~~~~~~~~~~~l~~le~~v~~~r~l~~~ea~~~~~i  457 (595)
                      ..+..+++...+.|...++.++|++|||+++ +++|+.++.++++++++++++|+|+||||||++||+|||.||+|||+|
T Consensus         3 lTr~~Dy~~~te~gkes~KdrLCIeILEq~~~rr~p~~~eas~s~~~~~ddL~mrLLyLENRValARllFP~EAkvaMdI   82 (207)
T PF12313_consen    3 LTRAKDYNKKTEQGKESNKDRLCIEILEQEERRRNPMPGEASVSSPMAADDLHMRLLYLENRVALARLLFPMEAKVAMDI   82 (207)
T ss_pred             cCchhhhccchhhccccccCcchHHHHHHHHHhcCCCccccccccccchHhhhhhHHHHHHHHHHHHHhhhHHHHHHHHH
Confidence            3456778888999999999999999999999 799999999999999999999999999999999999999999999999


Q ss_pred             hccCCCcccccccccCCCCCCCCcccccCCCCchHHHHHHHHHHHHHHHHHhhCCccCCCChHHHHhhh-hCCCcccccc
Q 007619          458 ADADATNFYTGLSASKSKGSSGNLKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFL-DCDWSDASLL  536 (595)
Q Consensus       458 a~~~~~~e~~~~~~~~~~~~~~~~~~~~l~e~p~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~-~~~~~~~~~~  536 (595)
                      |+++||.||++..+.+++++.+++++|||||+|++|+++|++||+||+||||+|||||||||+|||||| +||++|++++
T Consensus        83 A~~d~T~Eft~~s~~~~~~~~~~~~~vDLNetP~~~~~~l~~Rl~AL~KTVElGrRfFP~CSeVLdK~md~ddl~dl~~l  162 (207)
T PF12313_consen   83 AQADGTSEFTGLSASPSKGSGGNRSEVDLNETPFKQNERLLSRLRALSKTVELGRRFFPRCSEVLDKIMDDDDLPDLAYL  162 (207)
T ss_pred             HccCccccccccccccccCCccccCcCccccCcHHHHHHHHHHHHHHHHHHHhccccCccHHHHHHHHhccCcchhhhhc
Confidence            999999999999887888999999999999999999999999999999999999999999999999999 5669999999


Q ss_pred             cCCChHHHHHHHHhhHHHHHHHHHHhhhhHhhhhccccccCCC
Q 007619          537 ENGTPEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGLSSSSS  579 (595)
Q Consensus       537 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  579 (595)
                      |+||||||++|||||+||||+|||||+|||||+++|++|||||
T Consensus       163 e~~t~eeq~~Kr~Rf~ELke~v~kAFskDkeE~~~s~~ssSsS  205 (207)
T PF12313_consen  163 EKGTPEEQLVKRMRFMELKEDVQKAFSKDKEEFDRSSLSSSSS  205 (207)
T ss_pred             cCCCHHHHHHHHHHHHHHHHHHHHHHhhhHHHhcccccCcCCC
Confidence            9999999999999999999999999999999999999999885

The eukaryotic proteins are typically between 251 and 588 amino acids in length. NPR1/NIM1 like defence protein mediates the binding of TGA factors to the as-1 motif, found in the pathogenesis-related PR-1 gene which leads to the transcriptional regulation of the gene defence. Controls the onset of systemic acquired resistance (SAR) [].
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF12313 NPR1_like_C: NPR1/NIM1 like defence protein C terminal; InterPro: IPR021094 This entry represents the NPR1/NIM1 like defence protein, which is found in many plant species [] Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-04
3ga1_A129 Crystal Structure Of The Human Nac1 Poz Domain Leng 6e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
Query: 327 ADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYI 386
           AD+N K   G++ LH AA++    ++  LL  GA  +E +SDG T +AI +R+     YI
Sbjct: 335 ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRL----GYI 390
Query: 387 EAT 389
             T
Sbjct: 391 SVT 393
>pdb|3GA1|A Chain A, Crystal Structure Of The Human Nac1 Poz Domain Length = 129 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 3e-12
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 9e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-09
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-04
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 8e-10
2rfa_A232 Transient receptor potential cation channel subfa 1e-09
2rfa_A232 Transient receptor potential cation channel subfa 3e-07
2rfa_A232 Transient receptor potential cation channel subfa 2e-06
2rfa_A232 Transient receptor potential cation channel subfa 3e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-05
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 8e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-04
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 2e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-06
3b84_A119 Zinc finger and BTB domain-containing protein 48; 4e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-05
2vpk_A116 Myoneurin; transcription regulation, transcription 5e-08
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 5e-08
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 6e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-07
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 6e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-05
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 6e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-06
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 2e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-07
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 4e-07
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 5e-07
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 5e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-07
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 7e-07
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 7e-07
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 1e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-05
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 4e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-05
2pnn_A273 Transient receptor potential cation channel subfa 4e-05
2pnn_A273 Transient receptor potential cation channel subfa 3e-04
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 8e-05
2etb_A256 Transient receptor potential cation channel subfam 1e-04
2etb_A256 Transient receptor potential cation channel subfam 3e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-04
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
 Score = 64.2 bits (157), Expect = 3e-12
 Identities = 39/188 (20%), Positives = 72/188 (38%), Gaps = 38/188 (20%)

Query: 48  SKLSSNLEKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVS 107
            +L+  L  L  ++   +TD  + V G+    H+ IL+ARS  F  +F+         + 
Sbjct: 19  CRLADELGGLWENSR--FTDCCLCVAGQEFQAHKAILAARSPVFSAMFE-------HEME 69

Query: 108 EGKPKYLMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINY 167
           E K        V    V  E F  ++ + YTGK                           
Sbjct: 70  ESK-----KNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMA------------------- 105

Query: 168 AIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVV 227
             +L+ A+  + ++ L ++ +  L + +    VE+   IL+ A     +QL++  V   +
Sbjct: 106 -DDLLAAADKYALERLKVMCEDALCSNLS---VENAAEILILADLHSADQLKTQAV-DFI 160

Query: 228 RSNLDDVC 235
             +  DV 
Sbjct: 161 NYHATDVL 168
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.96
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.96
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.96
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.96
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.96
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.96
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.96
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.96
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.95
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.95
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.95
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.95
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.95
2rfa_A232 Transient receptor potential cation channel subfa 99.95
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.95
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.95
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.95
3hra_A201 Ankyrin repeat family protein; structural protein; 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.95
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.95
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.94
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.94
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.94
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.94
2pnn_A273 Transient receptor potential cation channel subfa 99.94
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.93
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.93
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.92
2etb_A256 Transient receptor potential cation channel subfam 99.92
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.92
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.92
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
3hra_A201 Ankyrin repeat family protein; structural protein; 99.92
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.91
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.91
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.91
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.91
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.91
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.9
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.9
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.89
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.89
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.88
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.88
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.88
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.87
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.87
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.87
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.85
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.85
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.85
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.85
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.85
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.84
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.83
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.83
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.83
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
2vpk_A116 Myoneurin; transcription regulation, transcription 99.81
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.81
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.81
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.81
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.81
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.8
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.8
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.79
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.79
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.79
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.79
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.77
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.77
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.76
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.75
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.75
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.74
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.73
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.73
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.73
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.73
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.71
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.7
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.7
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.63
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 98.88
4ajy_C97 Transcription elongation factor B polypeptide 1; E 98.62
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.23
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.03
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 97.63
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 97.52
2fnj_C96 Transcription elongation factor B polypeptide 1; b 97.39
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 96.88
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 96.28
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 95.81
3kvt_A115 Potassium channel protein SHAW; tetramerization do 92.15
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 91.08
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 86.24
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 82.87
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=99.96  E-value=1.4e-28  Score=247.40  Aligned_cols=221  Identities=20%  Similarity=0.102  Sum_probs=196.8

Q ss_pred             HHHHHHHHHHcChHHHHHHHHHcCCCchhhcccCCcHHHHHHHHHcCh----HHHHhchhhccccCCCCcccccccCCcc
Q 007619          168 AIELMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQL----NQLRSHCVQRVVRSNLDDVCLEKELPDE  243 (595)
Q Consensus       168 v~elL~~A~~~~l~~L~~l~~~~l~~~~~k~~~~n~~t~L~~A~~~~~----~~Ll~~~~~~i~~~~~~~t~L~~al~~~  243 (595)
                      ...+|+.|+..+..++++++++.+.+++... ...+.||||+|+..+.    +.|++.++++..++..+.|+++.++..+
T Consensus         5 g~~~L~~A~~~g~~~~v~~Ll~~g~~~~~~~-~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~   83 (285)
T 1wdy_A            5 DNHLLIKAVQNEDVDLVQQLLEGGANVNFQE-EEGGWTPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFLLAAIAG   83 (285)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHTTCCTTCCC-TTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHHT
T ss_pred             cchHHHHHHHcCCHHHHHHHHHcCCCccccc-CCCCCcHHHHHHHcCCHHHHHHHHHcCCCCcccCCCCCCHHHHHHHcC
Confidence            4578999999999999999999998877642 4567899999999997    6788888999889999999999988887


Q ss_pred             hHHHHHHHHhhhcccccccccccCCCCCCCCcHHHHHHhcCCHHHHHHHHHCC-CC-------------CCCCchHHHHH
Q 007619          244 VSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDES-NV-------------TLDDAYALHYA  309 (595)
Q Consensus       244 ~l~~ii~lL~~~~~~~Ga~~~~~~~~d~~g~tpLh~A~~~g~~e~v~~LL~~g-~i-------------n~~G~tpLh~A  309 (595)
                      . .+++++|+    ++|++++..   +..|.||||+|+..|+.+++++|++.| ++             +..|.||||+|
T Consensus        84 ~-~~~v~~Ll----~~g~~~~~~---~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~~~~~~~g~t~L~~A  155 (285)
T 1wdy_A           84 S-VKLLKLFL----SKGADVNEC---DFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDA  155 (285)
T ss_dssp             C-HHHHHHHH----HTTCCTTCB---CTTCCBHHHHHHHTTCHHHHHHHHHTTCCTTCCCCCCHHHHHTTCCCCCHHHHH
T ss_pred             C-HHHHHHHH----HcCCCCCcc---CcccCCHHHHHHHhCCHHHHHHHHHhCCCcccccccHHHHHhhccCCCcHHHHH
Confidence            7 66777773    458888877   889999999999999999999999999 44             45689999999


Q ss_pred             HHcCCHHHHHHHHHcCCCCccccCCCCChHHHHHHHcCC----HHHHHHHHhCCCCccccCCCCCcHHHHHHHcCChhhH
Q 007619          310 AAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKE----PAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDY  385 (595)
Q Consensus       310 a~~g~~~~v~~LL~~~~advn~~d~~G~TpLh~Aa~~~~----~~iv~~LL~~Gad~n~~d~~G~TpL~~A~~~~~~~~v  385 (595)
                      +..|+.++++.|+...|++++.+|..|+||||+|+..++    .+++++|+++|++++.+|..|+||||+|+..|+.+++
T Consensus       156 ~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~i~~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v  235 (285)
T 1wdy_A          156 AEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLV  235 (285)
T ss_dssp             HHHTCHHHHHHHHHTSCCCTTCCCTTSCCHHHHHHHCSCTTTHHHHHHHHHHTTCCSSCCCTTSCCHHHHHHHTTCHHHH
T ss_pred             HHcCCHHHHHHHHHhcCCCCCccCCCCCCHHHHHHHccccchHHHHHHHHHHcCCCCCCcCCCCCcHHHHHHHcCCHHHH
Confidence            999999999999998559999999999999999999999    9999999999999999999999999999999999999


Q ss_pred             HHHHH-cCCCchh
Q 007619          386 IEATK-QGQETNK  397 (595)
Q Consensus       386 ~~l~~-~g~~~~~  397 (595)
                      +.|++ .|.++..
T Consensus       236 ~~Ll~~~g~~~~~  248 (285)
T 1wdy_A          236 QRLLEQEHIEIND  248 (285)
T ss_dssp             HHHHHSSSCCTTC
T ss_pred             HHHHhccCCCccc
Confidence            99998 7776543
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 595
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-05
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 9e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.004
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-04
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 1e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.8 bits (146), Expect = 2e-10
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 305 ALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASE 364
            LH A+   +  + K +L  G A  N+ N +  T LH+AAR     V   LL   A  + 
Sbjct: 3   PLHVASFMGHLPIVKNLLQRG-ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 365 TTSDGQTA 372
              D QT 
Sbjct: 62  KAKDDQTP 69
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.93
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.92
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.92
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.92
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.91
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.9
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.87
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.87
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.85
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.83
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.82
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.81
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.81
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.8
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.79
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.78
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.78
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.77
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.77
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.76
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.76
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.75
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.72
d3kvta_103 akv3.1 voltage-gated potassium channel {California 95.53
d1t1da_100 Shaker potassium channel {California sea hare (Apl 95.43
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 94.89
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 94.36
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 94.16
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=8.8e-29  Score=240.16  Aligned_cols=208  Identities=19%  Similarity=0.121  Sum_probs=174.0

Q ss_pred             HHHHHHHcChHHHHHHHHHcCCCchhhcccCCcHHHHHHHHHcChHH----HHhchhhccccCCCCcccccccCCcchHH
Q 007619          171 LMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQ----LRSHCVQRVVRSNLDDVCLEKELPDEVSG  246 (595)
Q Consensus       171 lL~~A~~~~l~~L~~l~~~~l~~~~~k~~~~n~~t~L~~A~~~~~~~----Ll~~~~~~i~~~~~~~t~L~~al~~~~l~  246 (595)
                      +..+|...++..+++++......+..+  +.+|.||||+|+.+|...    |+..+...........++++.+..... .
T Consensus         7 ~~~~a~~G~~~~v~~~l~~~~~~~~~~--D~~G~TpLh~Aa~~g~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~-~   83 (223)
T d1uoha_           7 VCNLAYSGKLEELKESILADKSLATRT--DQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGR-D   83 (223)
T ss_dssp             HHHHHHTTCHHHHHHHHHHCGGGGGCC--CTTSCCHHHHHHHHTCHHHHHHHHHHTCCSCCCCTTCCCHHHHHHHHTC-H
T ss_pred             HHHHHHhCCHHHHHHHHHhCCCcCcCc--CCCCCCHHHHHHHhhhhcccccccccccccccccccccccccccccccc-c
Confidence            344566666788888888887777766  678899999999999854    444445555555556666666665555 4


Q ss_pred             HHHHHHhhhcccccccccccCCCCCCCCcHHHHHHhcCCHHHHHHHHHCC-CC---CCCCchHHHHHHHcCCHHHHHHHH
Q 007619          247 EIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDES-NV---TLDDAYALHYAAAYCNPKVFKEVL  322 (595)
Q Consensus       247 ~ii~lL~~~~~~~Ga~~~~~~~~d~~g~tpLh~A~~~g~~e~v~~LL~~g-~i---n~~G~tpLh~Aa~~g~~~~v~~LL  322 (595)
                      +++++|+    ++|++++..   |.+|.||||+|+..|+.+++++|++.| ++   |..|.||||+|+..++.++++.|+
T Consensus        84 ~i~~~Ll----~~~~d~~~~---d~~g~tpL~~A~~~~~~e~~~~Ll~~g~d~~~~~~~~~t~L~~a~~~~~~~~~~~L~  156 (223)
T d1uoha_          84 EIVKALL----GKGAQVNAV---NQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILL  156 (223)
T ss_dssp             HHHHHHH----HTTCCTTCC---CTTCCCHHHHHHHHTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHH
T ss_pred             chhHHHh----ccCceeEee---CCCCCchhhHHHHcCCHHHHHHHHHCCCCCCCcCCCCCccchhhhhcCCcchhhhhc
Confidence            6677763    457888776   889999999999999999999999999 55   478999999999999999999999


Q ss_pred             HcCCCCccccCCCCChHHHHHHHcCCHHHHHHHHhCCCCccccCCCCCcHHHHHHHcCChhhHHHHHH
Q 007619          323 NMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYIEATK  390 (595)
Q Consensus       323 ~~~~advn~~d~~G~TpLh~Aa~~~~~~iv~~LL~~Gad~n~~d~~G~TpL~~A~~~~~~~~v~~l~~  390 (595)
                      ..+ +++|.+|..|+||||+|+..|+.++|++||++|||++.+|.+|+||||+|+ .|+.++++.|++
T Consensus       157 ~~~-~~i~~~d~~g~TpL~~Aa~~g~~~~v~~LL~~Gad~~~~d~~g~tpl~~A~-~~~~~i~~~Ll~  222 (223)
T d1uoha_         157 YYK-ASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAK-GGLGLILKRMVE  222 (223)
T ss_dssp             HTT-CCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCTTSCCHHHHCC-TTHHHHHHHHHC
T ss_pred             ccc-ceeeeccCCCCceeccccccCcHHHHHHHHHCCCCCCCCCCCCCCHHHHHH-CCCHHHHhcccC
Confidence            887 999999999999999999999999999999999999999999999999984 688888888764
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure