Citrus Sinensis ID: 007628


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-----
MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQCGRGGGSGGSGWGGSPAPATSPRSSPPSSSSPPPPKRKPPVVKPVPAPRPANSPGPFIRPSPPPPPTSKSSPSTRSHPTPPPPANSPPKSFHSPPSPPPPPPTHKESPRTHLPPTPPPVYNVSPSPKHFPPPPSHYHNTPPPPTKKASPSTHYAPPPPPRFYYVPKQSPPPPPPVEYYPPPYQQHMAPPPPPGESAEVPAPSYFAYSPPPPPARDENPVAPATPGAPVEYYPPKKGNPPPAPEYYHASPPPSGCDIIPPSHHHNPPSWHHQTPPSPNYHSYAVPPPPSPSPPTPPPSPYDNTPLPPIIGVSYASPPPPVIPYY
ccCCcccccccccccccccEEEccccccCCcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHcccccccEEccccccCCccccccccccccEEEcccccccccccHHHHHHHHHHcHHccccccccccccHHHcccccccEEEcccccccccccHHccccccccEEEccccccCCcccHHccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQCGRGGGSG***************************************************************************************************************************************************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQCGRGGGSGGSGWGGSPAPATSPRSSPPSSSSPPPPKRKPPVVKPVPAPRPANSPGPFIRPSPPPPPTSKSSPSTRSHPTPPPPANSPPKSFHSPPSPPPPPPTHKESPRTHLPPTPPPVYNVSPSPKHFPPPPSHYHNTPPPPTKKASPSTHYAPPPPPRFYYVPKQSPPPPPPVEYYPPPYQQHMAPPPPPGESAEVPAPSYFAYSPPPPPARDENPVAPATPGAPVEYYPPKKGNPPPAPEYYHASPPPSGCDIIPPSHHHNPPSWHHQTPPSPNYHSYAVPPPPSPSPPTPPPSPYDNTPLPPIIGVSYASPPPPVIPYY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Leucine-rich repeat extensin-like protein 2 Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization. Together with LRX2, component of the extracellular mechanism regulating root hair morphogenesis and elongation.probableO48809

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 12-270
View the alignment between query and template
View the model in PyMOL
Template: 3V1V, chain A
Confidence level:probable
Coverage over the Query: 423-432
View the alignment between query and template
View the model in PyMOL
Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 418-467
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 527-590
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 527-590
View the alignment between query and template
View the model in PyMOL