Citrus Sinensis ID: 007628


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-----
MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQCGRGGGSGGSGWGGSPAPATSPRSSPPSSSSPPPPKRKPPVVKPVPAPRPANSPGPFIRPSPPPPPTSKSSPSTRSHPTPPPPANSPPKSFHSPPSPPPPPPTHKESPRTHLPPTPPPVYNVSPSPKHFPPPPSHYHNTPPPPTKKASPSTHYAPPPPPRFYYVPKQSPPPPPPVEYYPPPYQQHMAPPPPPGESAEVPAPSYFAYSPPPPPARDENPVAPATPGAPVEYYPPKKGNPPPAPEYYHASPPPSGCDIIPPSHHHNPPSWHHQTPPSPNYHSYAVPPPPSPSPPTPPPSPYDNTPLPPIIGVSYASPPPPVIPYY
ccEEcccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHccccccEEccccccEEccccccccccccEEEcccccccccccHHHHHHHHHHcHHccccccccccccHHHcccccccEEEcccccccccccHHccccccccEEEccccccEEcccHHccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccEEEEcccccccccccHHHccccEEEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccHHEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccEccccccHHccccccccccccccccccEEcccccccccccccccccccccccEEEcccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccEccc
mgvfcarspfnspslrVVASIdlnhadiagylppeigrlTDLAIFHinsnrfcgvvpsTFRRLKLLYEVdlsnnrfvgkfpklflslpklkyldlrfnefegsvpsklfdkdldaiflndnrfqfgipenlgnspvSVLVFANndlggcipgsigkmgKTLNEIILMndnltgclppqigmlknlTVFDVSfnhlqgslpssignmkSLEQLNVAHNrftgvipssvcqlpnlqnftysfnyftgeppsctaaaggggrmmaarpadcskmqcgrgggsggsgwggspapatsprssppssssppppkrkppvvkpvpaprpanspgpfirpsppppptsksspstrshptppppansppksfhsppsppppppthkesprthlpptpppvynvspspkhfppppshyhntpppptkkaspsthyappppprfyyvpkqsppppppveyypppyqqhmapppppgesaevpapsyfayspppppardenpvapatpgapveyyppkkgnpppapeyyhaspppsgcdiippshhhnppswhhqtppspnyhsyavppppspspptpppspydntplppiigvsyasppppvipyy
mgvfcarspfnspsLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVdlsnnrfvgkFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQCGRGGGSGGSGWGGSPAPATSPrssppssssppppkrkppvvKPVPAPRPANspgpfirpsppppPTSKSSPSTRSHPTPPPPANSPPKSFHSPPSPPPPPPTHKESPRTHLPPTPPPVYNVSPSPKHFPPPPSHYHNTPPPPTKKASPSTHYAPPPPPRFYYVPKQSPPPPPPVEYYPPPYQQHMAPPPPPGESAEVPAPSYFAYSPPPPPARDENPVAPATPGAPVEYYPPKKGNPPPAPEYYHASPPPSGCDIIPPSHHHNPPSWHHQTPPSPNYHSYAVPPPPSPSPPTPPPSPYDNTPLPPIIGVSyasppppvIPYY
MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGkfpklflslpklkyldlRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTaaaggggrmmaarPADCSKMQCgrgggsggsgwggspapatsprssppssssppppkrkppvvkpvpaprpANspgpfirpsppppptsksspstrshptppppansppksfhsppsppppppthkesprthlpptpppvynvspspkhfppppshyhntpppptkkaspstHYApppppRFyyvpkqsppppppveyypppyqqhmapppppgesaevpapsyfayspppppaRDENPVAPATPGAPVEYYppkkgnpppapEYYHASPPPSGCDIIppshhhnppswhhQTPPSPNYHSYAVppppspspptpppspydntplppIIGVSYASPPPPVIPYY
************PSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGE*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQCGRGGGSG***************************************************************************************************************************************************************************************************************************************************************************************************************************
MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQ******************************************KPVPAPRPANSPGPFIRPS**************************************************LPPTPPPVYNVSPSPKHFPPPP********************APPPPPRFYYVPKQSPPPPPPVEYYPPPYQQHMAPPPPPGESAEVPAPSYFAYSPPPPPARDENPVAPATPGAPVEYYPPKKGNPPPAPEYYHASPPPSGCDIIPPSHH***********PSPNYHSY****************PYDNTPLPPIIGVSYASPPPPVIPYY
*GVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQCGRGGGSGGSGWGGSPAPATSPRSSPPSSSSPPPPKRKPPVVKPVPAPRPANSPGPFIRPSPP***************T*PPP*****KSFHSPPSP*************HLPPTPPPVYNVSPSPKHFPPPPSHYHNT*P**TK****STHYAPPPPPRFYYVPKQSPPPPPPVEYYPPPYQQHMAPPPPPGESAEVPAPSYFAYSPPPPPARDENPVAPATPGAPVEYYPPKKGNPPPAPEYYHASPPPSGCDIIPPSHHHNPPSWHHQTPPSPNYHSYAVPPPPSPSPPTPPPSPYDNTPLPPIIGVSYASPPPPVIPYY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCSKMQCGRGGGSGGSGWGGSPAPATSPRSSPPSSSSPPPPKRKPPVVKPVPAPRPANSPGPFIRPSPPPPPTSKSSPSTRSHPTPPPPANSPPKSFHSPPSPPPPPPTHKESPRTHLPPTPPPVYNVSPSPKHFPPPPSHYHNTPPPPTKKASPSTHYAPPPPPRFYYVPKQSPPPPPPVEYYPPPYQQHMAPPPPPGESAEVPAPSYFAYSPPPPPARDENPVAPATPGAPVEYYPPKKGNPPPAPEYYHASPPPSGCDIIPPSHHHNPPSWHHQTPPSPNYHSYAVPPPPSPSPPTPPPSPYDNTPLPPIIGVSYASPPPPVIPYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query595 2.2.26 [Sep-21-2011]
O48809786 Leucine-rich repeat exten yes no 0.455 0.344 0.713 1e-119
O65375744 Leucine-rich repeat exten no no 0.455 0.364 0.675 1e-113
Q9SN46 857 Leucine-rich repeat exten no no 0.457 0.317 0.613 1e-98
Q9LHF1494 Leucine-rich repeat exten no no 0.453 0.546 0.627 4e-98
Q9T0K5760 Leucine-rich repeat exten no no 0.457 0.357 0.592 2e-97
Q9LUI1470 Leucine-rich repeat exten no no 0.455 0.576 0.610 2e-94
Q9XIB6 847 Pollen-specific leucine-r no no 0.453 0.318 0.532 5e-94
Q9LJ64 956 Pollen-specific leucine-r no no 0.455 0.283 0.517 8e-92
Q4PSE6433 Leucine-rich repeat exten no no 0.455 0.625 0.532 1e-88
O81765699 Pollen-specific leucine-r no no 0.586 0.499 0.452 2e-88
>sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=1 SV=1 Back     alignment and function desciption
 Score =  429 bits (1103), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 234/293 (79%), Gaps = 22/293 (7%)

Query: 2   GVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFR 61
           G+FCA SP +SP  RVVA IDLNHAD+AGYLP E+G LTDLA+FH+NSNRFCG VP TF+
Sbjct: 88  GIFCAPSP-SSPKTRVVAGIDLNHADMAGYLPRELGLLTDLALFHLNSNRFCGEVPLTFK 146

Query: 62  RLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDN 121
            +KLL+E+DLSNNRFVGKFP + LSLP LK+LDLR+NEFEGS+PSKLFDK+LDAIFLN N
Sbjct: 147 HMKLLFELDLSNNRFVGKFPNVVLSLPSLKFLDLRYNEFEGSIPSKLFDKELDAIFLNHN 206

Query: 122 RFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGM 181
           RF FGIPEN+GNSPVS LV A+NDLGGCIPGSIG MGKTLNEIIL NDNLTGCLPPQIG 
Sbjct: 207 RFMFGIPENMGNSPVSALVLADNDLGGCIPGSIGLMGKTLNEIILSNDNLTGCLPPQIGN 266

Query: 182 LKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFN 241
           LKN+TVFD+SFN L G LPSSIGNMKSLEQLNVA+NRFTGVIPSS+CQL NL+NFTYS N
Sbjct: 267 LKNVTVFDISFNRLSGPLPSSIGNMKSLEQLNVANNRFTGVIPSSICQLSNLENFTYSSN 326

Query: 242 YFTGEPPSCTAAAGG----GGRMM-----------------AARPADCSKMQC 273
           +FTG+ P C A  G      G M                  A+R  DCSK  C
Sbjct: 327 FFTGDAPRCVALLGDNVVVNGSMNCIDGKEDQRSSKECSSPASRSVDCSKFGC 379




Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization. Together with LRX2, component of the extracellular mechanism regulating root hair morphogenesis and elongation.
Arabidopsis thaliana (taxid: 3702)
>sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SN46|LRX5_ARATH Leucine-rich repeat extensin-like protein 5 OS=Arabidopsis thaliana GN=LRX5 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHF1|LRX4_ARATH Leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=LRX4 PE=1 SV=1 Back     alignment and function description
>sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIB6|PLRX2_ARATH Pollen-specific leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=PEX2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJ64|PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=1 Back     alignment and function description
>sp|Q4PSE6|LRX7_ARATH Leucine-rich repeat extensin-like protein 7 OS=Arabidopsis thaliana GN=LRX7 PE=2 SV=1 Back     alignment and function description
>sp|O81765|PLRX4_ARATH Pollen-specific leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=PEX4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
224087373525 predicted protein [Populus trichocarpa] 0.457 0.518 0.776 1e-129
255546868 766 LRX2, putative [Ricinus communis] gi|223 0.519 0.403 0.719 1e-129
224118538481 predicted protein [Populus trichocarpa] 0.467 0.577 0.754 1e-126
359483094610 PREDICTED: leucine-rich repeat extensin- 0.482 0.470 0.717 1e-124
127058161 725 leucine-rich repeat/extensin [Nicotiana 0.452 0.371 0.707 1e-117
75318316 786 RecName: Full=Leucine-rich repeat extens 0.455 0.344 0.713 1e-117
15220780 826 leucine-rich repeat/extensin 2 [Arabidop 0.455 0.328 0.713 1e-117
297840287 713 hypothetical protein ARALYDRAFT_475099 [ 0.455 0.380 0.709 1e-117
127058169 723 leucine-rich repeat/extensin 1 [Nicotian 0.452 0.372 0.697 1e-116
15221178 744 leucine-rich repeat extensin-like protei 0.455 0.364 0.675 1e-111
>gi|224087373|ref|XP_002308141.1| predicted protein [Populus trichocarpa] gi|222854117|gb|EEE91664.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  469 bits (1207), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 226/291 (77%), Positives = 246/291 (84%), Gaps = 19/291 (6%)

Query: 1   MGVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTF 60
           MG+FCA SP N   +RVVA IDLNHADIAGYLP E+G LTDLA+FHINSNRFCGVVP++F
Sbjct: 83  MGIFCAPSPQNK-KVRVVAGIDLNHADIAGYLPTELGLLTDLALFHINSNRFCGVVPNSF 141

Query: 61  RRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLND 120
            ++KLL+E+DLSNNRFVGKFPK+ LSLP LKYLDLRFNEFEGSVPS+LFDK LDAIFLND
Sbjct: 142 SKMKLLHELDLSNNRFVGKFPKVVLSLPSLKYLDLRFNEFEGSVPSQLFDKPLDAIFLND 201

Query: 121 NRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIG 180
           NRFQFGIPENLGNSPVSVLVFANN+LGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIG
Sbjct: 202 NRFQFGIPENLGNSPVSVLVFANNNLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIG 261

Query: 181 MLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSF 240
           MLK +TVFDVSFNHLQGSLPSSIGNMKS+EQL++AHN FTG IP+SVCQLPNLQNFT+SF
Sbjct: 262 MLKEVTVFDVSFNHLQGSLPSSIGNMKSVEQLDIAHNSFTGAIPASVCQLPNLQNFTFSF 321

Query: 241 NYFTGEPPSCTAAAGGGGRMM------------------AARPADCSKMQC 273
           NYFTGE PSC A  G                        AARP DCSK +C
Sbjct: 322 NYFTGEAPSCAAIGGVSNGTQNCIPGKTNQRSAKQCSSEAARPVDCSKFKC 372




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255546868|ref|XP_002514492.1| LRX2, putative [Ricinus communis] gi|223546391|gb|EEF47892.1| LRX2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224118538|ref|XP_002331387.1| predicted protein [Populus trichocarpa] gi|222873601|gb|EEF10732.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359483094|ref|XP_002274545.2| PREDICTED: leucine-rich repeat extensin-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|127058161|dbj|BAF48663.1| leucine-rich repeat/extensin [Nicotiana plumbaginifolia] gi|127058167|dbj|BAF48664.1| leucine-rich repeat/extensin [Nicotiana plumbaginifolia] Back     alignment and taxonomy information
>gi|75318316|sp|O48809.1|LRX2_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 2; Short=AtLRX2; Short=LRR/EXTENSIN2; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|5454187|gb|AAD43602.1|AC005698_1 T3P18.1 [Arabidopsis thaliana] gi|7940282|gb|AAF70841.1|AC003113_8 F24O1.18 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15220780|ref|NP_176434.1| leucine-rich repeat/extensin 2 [Arabidopsis thaliana] gi|332195847|gb|AEE33968.1| leucine-rich repeat/extensin 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297840287|ref|XP_002888025.1| hypothetical protein ARALYDRAFT_475099 [Arabidopsis lyrata subsp. lyrata] gi|297333866|gb|EFH64284.1| hypothetical protein ARALYDRAFT_475099 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|127058169|dbj|BAF48665.1| leucine-rich repeat/extensin 1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|15221178|ref|NP_172668.1| leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana] gi|75318540|sp|O65375.1|LRX1_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 1; Short=AtLRX1; Short=LRR/EXTENSIN1; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|3157926|gb|AAC17609.1| Strong similarity to extensin-like protein gb|Z34465 from Zea mays [Arabidopsis thaliana] gi|13809918|gb|AAK07681.1| leucine-rich repeat/extensin 1 [Arabidopsis thaliana] gi|332190708|gb|AEE28829.1| leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
TAIR|locus:2008895744 LRX1 "AT1G12040" [Arabidopsis 0.416 0.333 0.698 1.5e-100
TAIR|locus:2124142 857 AT4G18670 "AT4G18670" [Arabido 0.415 0.288 0.634 3.8e-93
TAIR|locus:2142105760 LRX3 "AT4G13340" [Arabidopsis 0.415 0.325 0.622 2.9e-90
TAIR|locus:2094854494 AT3G24480 [Arabidopsis thalian 0.415 0.5 0.618 8.1e-87
TAIR|locus:2094389470 AT3G22800 "AT3G22800" [Arabido 0.416 0.527 0.616 4.5e-84
TAIR|locus:2085889 956 AT3G19020 [Arabidopsis thalian 0.415 0.258 0.546 6.6e-79
TAIR|locus:2010247 847 AT1G49490 [Arabidopsis thalian 0.415 0.291 0.554 9.5e-78
TAIR|locus:2118949699 AT4G33970 [Arabidopsis thalian 0.415 0.353 0.538 2.9e-74
TAIR|locus:2179449433 AT5G25550 "AT5G25550" [Arabido 0.416 0.572 0.550 9.6e-73
TAIR|locus:2044576727 AT2G15880 [Arabidopsis thalian 0.415 0.339 0.514 2.6e-71
TAIR|locus:2008895 LRX1 "AT1G12040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 933 (333.5 bits), Expect = 1.5e-100, Sum P(3) = 1.5e-100
 Identities = 174/249 (69%), Positives = 204/249 (81%)

Query:     2 GVFCARSPFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFR 61
             G++CA SP + P  RVVA IDLNHAD+AGYL  E+G L+DLA+FHINSNRFCG VP TF 
Sbjct:    86 GIYCAPSP-SYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFHINSNRFCGEVPLTFN 144

Query:    62 RLKLLYEVDLSNNRFVGXXXXXXXXXXXXXXXXXRFNEFEGSVPSKLFDKDLDAIFLNDN 121
             R+KLLYE+DLSNNRFVG                 R+NEFEG +PSKLFD++LDAIFLN N
Sbjct:   145 RMKLLYELDLSNNRFVGKFPKVVLSLPSLKFLDLRYNEFEGKIPSKLFDRELDAIFLNHN 204

Query:   122 RFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGM 181
             RF+FGIP+N+GNSPVS LV A+N+LGGCIPGSIG+MGKTLNE+IL NDNLTGCLPPQIG 
Sbjct:   205 RFRFGIPKNMGNSPVSALVLADNNLGGCIPGSIGQMGKTLNELILSNDNLTGCLPPQIGN 264

Query:   182 LKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFN 241
             LK +TVFD++ N LQG LPSS+GNMKSLE+L+VA+N FTGVIP S+CQL NL+NFTYS N
Sbjct:   265 LKKVTVFDITSNRLQGPLPSSVGNMKSLEELHVANNAFTGVIPPSICQLSNLENFTYSSN 324

Query:   242 YFTGEPPSC 250
             YF+G PP C
Sbjct:   325 YFSGRPPIC 333


GO:0009927 "histidine phosphotransfer kinase activity" evidence=NAS
GO:0000904 "cell morphogenesis involved in differentiation" evidence=IMP
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0009826 "unidimensional cell growth" evidence=IMP
GO:0010054 "trichoblast differentiation" evidence=RCA;IMP
GO:0005199 "structural constituent of cell wall" evidence=ISS
GO:0009506 "plasmodesma" evidence=IDA
GO:0048527 "lateral root development" evidence=RCA
GO:0048589 "developmental growth" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
TAIR|locus:2124142 AT4G18670 "AT4G18670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142105 LRX3 "AT4G13340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094854 AT3G24480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094389 AT3G22800 "AT3G22800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085889 AT3G19020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010247 AT1G49490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118949 AT4G33970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179449 AT5G25550 "AT5G25550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044576 AT2G15880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O48809LRX2_ARATHNo assigned EC number0.71330.45540.3447yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-28
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-25
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-24
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-23
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-20
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-18
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-17
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-15
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-14
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-13
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-13
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-13
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-12
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 8e-12
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-11
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-11
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 3e-11
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 5e-11
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 6e-11
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-11
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 7e-11
pfam04652315 pfam04652, DUF605, Vta1 like 1e-10
pfam04652315 pfam04652, DUF605, Vta1 like 2e-10
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 8e-10
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 9e-10
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 3e-09
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-09
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-09
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 5e-09
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 6e-09
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 9e-09
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 1e-08
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-08
pfam04652315 pfam04652, DUF605, Vta1 like 3e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-08
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 7e-08
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-07
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-07
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-07
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-07
pfam04652315 pfam04652, DUF605, Vta1 like 1e-07
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-07
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 2e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 2e-07
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-07
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
pfam04652315 pfam04652, DUF605, Vta1 like 5e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 6e-07
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 6e-07
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 7e-07
pfam04652315 pfam04652, DUF605, Vta1 like 7e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-07
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 9e-07
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
pfam04652315 pfam04652, DUF605, Vta1 like 1e-06
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-06
PRK08691709 PRK08691, PRK08691, DNA polymerase III subunits ga 1e-06
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-06
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-06
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 2e-06
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-06
pfam04652315 pfam04652, DUF605, Vta1 like 3e-06
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 3e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-06
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-06
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 4e-06
pfam04652315 pfam04652, DUF605, Vta1 like 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 9e-06
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-05
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-05
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-05
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 2e-05
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 2e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-05
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 2e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-05
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 3e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 5e-05
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 5e-05
PHA033771000 PHA03377, PHA03377, EBNA-3C; Provisional 5e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 5e-05
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 7e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 7e-05
pfam04652315 pfam04652, DUF605, Vta1 like 8e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 8e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 8e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 8e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 9e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 1e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 1e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 1e-04
PLN02217670 PLN02217, PLN02217, probable pectinesterase/pectin 1e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 1e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-04
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 2e-04
PHA03132 580 PHA03132, PHA03132, thymidine kinase; Provisional 2e-04
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 2e-04
pfam08580626 pfam08580, KAR9, Yeast cortical protein KAR9 2e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-04
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 3e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-04
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 3e-04
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-04
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 3e-04
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 4e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 4e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 5e-04
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 6e-04
PTZ00449943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 6e-04
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 6e-04
pfam04484313 pfam04484, DUF566, Family of unknown function (DUF 6e-04
PHA03321694 PHA03321, PHA03321, tegument protein VP11/12; Prov 6e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 7e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 7e-04
pfam01044850 pfam01044, Vinculin, Vinculin family 7e-04
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 8e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 8e-04
PTZ00436357 PTZ00436, PTZ00436, 60S ribosomal protein L19-like 8e-04
PRK10856331 PRK10856, PRK10856, cytoskeletal protein RodZ; Pro 8e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 9e-04
PHA03377 1000 PHA03377, PHA03377, EBNA-3C; Provisional 9e-04
PHA03132 580 PHA03132, PHA03132, thymidine kinase; Provisional 9e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 0.001
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 0.001
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.001
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.001
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 0.001
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 0.001
pfam04484313 pfam04484, DUF566, Family of unknown function (DUF 0.001
PHA03321694 PHA03321, PHA03321, tegument protein VP11/12; Prov 0.001
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.001
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.001
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.001
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.002
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.002
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.002
TIGR00859595 TIGR00859, ENaC, sodium channel transporter 0.002
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.002
pfam11711377 pfam11711, Tim54, Inner membrane protein import co 0.002
pfam03999619 pfam03999, MAP65_ASE1, Microtubule associated prot 0.002
pfam05539408 pfam05539, Pneumo_att_G, Pneumovirinae attachment 0.002
PHA03369 663 PHA03369, PHA03369, capsid maturational protease; 0.002
PLN02258 590 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen 0.002
PHA03269 566 PHA03269, PHA03269, envelope glycoprotein C; Provi 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.003
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 0.003
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.003
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.003
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.003
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.003
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.003
TIGR00859595 TIGR00859, ENaC, sodium channel transporter 0.003
PHA03369663 PHA03369, PHA03369, capsid maturational protease; 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.004
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.004
PRK10856331 PRK10856, PRK10856, cytoskeletal protein RodZ; Pro 0.004
pfam05539408 pfam05539, Pneumo_att_G, Pneumovirinae attachment 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  128 bits (322), Expect = 7e-31
 Identities = 81/234 (34%), Positives = 127/234 (54%), Gaps = 6/234 (2%)

Query: 18  VASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVP-STFRRLKLLYEVDLSNNRF 76
           V SIDL+  +I+G +   I RL  +   ++++N+  G +P   F     L  ++LSNN F
Sbjct: 71  VVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNF 130

Query: 77  VGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKL-FDKDLDAIFLNDNRFQFGIPENLGN-S 134
            G  P+  +    L+ LDL  N   G +P+ +     L  + L  N     IP +L N +
Sbjct: 131 TGSIPRGSIPN--LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLT 188

Query: 135 PVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNH 194
            +  L  A+N L G IP  +G+M K+L  I L  +NL+G +P +IG L +L   D+ +N+
Sbjct: 189 SLEFLTLASNQLVGQIPRELGQM-KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNN 247

Query: 195 LQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPP 248
           L G +PSS+GN+K+L+ L +  N+ +G IP S+  L  L +   S N  +GE P
Sbjct: 248 LTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIP 301


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|177614 PHA03377, PHA03377, EBNA-3C; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215130 PLN02217, PLN02217, probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|219916 pfam08580, KAR9, Yeast cortical protein KAR9 Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|218107 pfam04484, DUF566, Family of unknown function (DUF566) Back     alignment and domain information
>gnl|CDD|223041 PHA03321, PHA03321, tegument protein VP11/12; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|216263 pfam01044, Vinculin, Vinculin family Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|177614 PHA03377, PHA03377, EBNA-3C; Provisional Back     alignment and domain information
>gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|218107 pfam04484, DUF566, Family of unknown function (DUF566) Back     alignment and domain information
>gnl|CDD|223041 PHA03321, PHA03321, tegument protein VP11/12; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|233154 TIGR00859, ENaC, sodium channel transporter Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|221179 pfam11711, Tim54, Inner membrane protein import complex subunit Tim54 Back     alignment and domain information
>gnl|CDD|217835 pfam03999, MAP65_ASE1, Microtubule associated protein (MAP65/ASE1 family) Back     alignment and domain information
>gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G Back     alignment and domain information
>gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional Back     alignment and domain information
>gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED Back     alignment and domain information
>gnl|CDD|165527 PHA03269, PHA03269, envelope glycoprotein C; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|233154 TIGR00859, ENaC, sodium channel transporter Back     alignment and domain information
>gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 595
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.82
KOG0617264 consensus Ras suppressor protein (contains leucine 99.79
KOG4237498 consensus Extracellular matrix protein slit, conta 99.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
PLN032101153 Resistant to P. syringae 6; Provisional 99.75
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
PLN032101153 Resistant to P. syringae 6; Provisional 99.7
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.64
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.54
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.49
PLN03150623 hypothetical protein; Provisional 99.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.4
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.4
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.4
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.35
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.32
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
PLN03150623 hypothetical protein; Provisional 99.26
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.17
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.03
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.99
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.98
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.81
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.81
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.43
PRK15386426 type III secretion protein GogB; Provisional 98.36
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.21
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.1
PRK15386426 type III secretion protein GogB; Provisional 98.02
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
KOG4308478 consensus LRR-containing protein [Function unknown 97.76
KOG4341483 consensus F-box protein containing LRR [General fu 97.64
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.58
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.54
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.54
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.44
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.24
KOG4341483 consensus F-box protein containing LRR [General fu 97.1
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.09
KOG4308478 consensus LRR-containing protein [Function unknown 97.05
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.96
KOG0473326 consensus Leucine-rich repeat protein [Function un 96.73
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 96.67
KOG0473326 consensus Leucine-rich repeat protein [Function un 96.39
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 95.89
PHA03247 3151 large tegument protein UL36; Provisional 95.6
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.05
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.68
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 94.19
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.97
KOG1665302 consensus AFH1-interacting protein FIP2, contains 93.73
KOG1665302 consensus AFH1-interacting protein FIP2, contains 92.92
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.44
PRK15196350 secreted effector protein PipB2; Provisional 91.02
smart0037026 LRR Leucine-rich repeats, outliers. 90.41
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.83
PRK09718512 hypothetical protein; Validated 89.19
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.11
PRK09718512 hypothetical protein; Validated 88.06
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 87.51
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 87.14
smart0037026 LRR Leucine-rich repeats, outliers. 85.67
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.67
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 82.53
PRK15196350 secreted effector protein PipB2; Provisional 82.36
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.23
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.96  E-value=3.9e-30  Score=306.96  Aligned_cols=254  Identities=27%  Similarity=0.499  Sum_probs=199.6

Q ss_pred             CCceeEEEccCCCCCCCCchhhcCCCCCcEEEccCCcCCCCCchhhcCCCCCCEEeccCCcCCCcCchhcCCCCCCCEEE
Q 007628           15 LRVVASIDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLD   94 (595)
Q Consensus        15 l~~L~~LdLs~n~i~~~lp~~~~~L~~L~~L~Ls~N~l~~~lp~~~~~L~~L~~L~Ls~N~Lsg~lp~~l~~L~~L~~Ld   94 (595)
                      +.+|+.|+|++|++.+.++..+..+.+|+.|+|++|++.+.++.+|+++.+|+.|+|++|+|++.++..|.++.+|++||
T Consensus       355 ~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~  434 (968)
T PLN00113        355 HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLD  434 (968)
T ss_pred             CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEE
Confidence            34444444544444444444444455555555555555555566666677777777777777777777777777778888


Q ss_pred             ccCCCCCCCCCccccc-cCCCeeeccCCccccCCCcccCCCCceeEEeeccCCCCCcCcccccccchhhHHHhhccccCC
Q 007628           95 LRFNEFEGSVPSKLFD-KDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTG  173 (595)
Q Consensus        95 Ls~N~l~g~ip~~l~~-~~L~~L~L~~N~l~~~~p~~l~~~~L~~L~L~~N~l~~~ip~~l~~l~~~L~~L~Ls~N~l~g  173 (595)
                      |++|+|+|.++..+.. .+|+.|+|++|++.+.++..+...+|++|+|++|++.+.++..|..+ .+|++|+|++|++.+
T Consensus       435 Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l-~~L~~L~Ls~N~l~~  513 (968)
T PLN00113        435 ISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSL-SELMQLKLSENKLSG  513 (968)
T ss_pred             CcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhh-hccCEEECcCCccee
Confidence            8888877777665544 67888888888888888888877889999999999999999988888 789999999999999


Q ss_pred             CCCCccCCCccceEEeccCccccCCCCCCcCCCCCccEEEccCCcCCCCCchhccCCCCCcEEEcccccCCCCCCccccc
Q 007628          174 CLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAA  253 (595)
Q Consensus       174 ~ip~~~~~L~~L~~LdLs~N~L~g~lP~~l~~L~~L~~L~Ls~N~Lsg~iP~~l~~l~~L~~L~Ls~N~Lsg~~p~~~~~  253 (595)
                      .+++.|++|.+|++|+|++|.|+|.++..|+.|.+|++|||++|+|+|.++..+.++.+|+.|||++|+|+|.++.....
T Consensus       514 ~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~  593 (968)
T PLN00113        514 EIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAF  593 (968)
T ss_pred             eCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998876555


Q ss_pred             cCCCCcccccCCCCCC
Q 007628          254 AGGGGRMMAARPADCS  269 (595)
Q Consensus       254 ~~~~~~~~~~~~~~c~  269 (595)
                      .......+.+|...|+
T Consensus       594 ~~~~~~~~~~n~~lc~  609 (968)
T PLN00113        594 LAINASAVAGNIDLCG  609 (968)
T ss_pred             cccChhhhcCCccccC
Confidence            5444455566665654



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15196 secreted effector protein PipB2; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PRK15196 secreted effector protein PipB2; Provisional Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-17
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-17
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-12
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-08
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 88.2 bits (217), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 72/257 (28%), Positives = 111/257 (43%), Gaps = 28/257 (10%) Query: 21 IDLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVP----STFRRLKL----------- 65 +D++ ++G I T+L + +I+SN+F G +P + + L L Sbjct: 228 LDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPD 287 Query: 66 --------LYEVDLSNNRFVGXXXXXXXXXXXXXXXXXRFNEFEGSVP--SKLFDKDLDA 115 L +DLS N F G N F G +P + L + L Sbjct: 288 FLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKV 347 Query: 116 IFLNDNRFQFGIPENLGNSPVSVLVF---ANNDLGGCIPGSIGKMGKTLNEIILMNDNLT 172 + L+ N F +PE+L N S+L +NN G +P TL E+ L N+ T Sbjct: 348 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 407 Query: 173 GCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPN 232 G +PP + L +SFN+L G++PSS+G++ L L + N G IP + + Sbjct: 408 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 467 Query: 233 LQNFTYSFNYFTGEPPS 249 L+ FN TGE PS Sbjct: 468 LETLILDFNDLTGEIPS 484
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-53
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-50
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-49
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-49
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-35
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-06
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-20
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-19
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-18
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-16
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-16
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-13
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-09
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-08
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-16
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-14
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 9e-12
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-11
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-12
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-12
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-11
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-10
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 6e-09
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 6e-09
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 1e-08
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 4e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 6e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 8e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-08
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-08
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-07
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 9e-07
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 4e-06
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 6e-06
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 2e-07
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 1e-06
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 4e-06
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 8e-06
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 4e-05
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 5e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-06
3odw_A 536 RHO guanine nucleotide exchange factor 1; regulati 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 4e-07
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 2e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 1e-05
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 9e-05
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 5e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 6e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 7e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 8e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 3e-06
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 4e-06
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 1e-04
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 2e-05
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 2e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 5e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 8e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 6e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 2e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 8e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 5e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 6e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  194 bits (496), Expect = 2e-57
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 13/254 (5%)

Query: 2   GVFCARSPFNSPSLRVVASIDLNHADIAG--YLPPEIGRLTDLAIFHI-NSNRFCGVVPS 58
           GV C            V ++DL+  ++     +P  +  L  L   +I   N   G +P 
Sbjct: 40  GVLCD----TDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPP 95

Query: 59  TFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFD-KDLDAIF 117
              +L  L+ + +++    G  P     +  L  LD  +N   G++P  +    +L  I 
Sbjct: 96  AIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGIT 155

Query: 118 LNDNRFQFGIPENLGN--SPVSVLVFANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCL 175
            + NR    IP++ G+     + +  + N L G IP +   +   L  + L  + L G  
Sbjct: 156 FDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL--NLAFVDLSRNMLEGDA 213

Query: 176 PPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQN 235
               G  KN     ++ N L   L   +G  K+L  L++ +NR  G +P  + QL  L +
Sbjct: 214 SVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHS 272

Query: 236 FTYSFNYFTGEPPS 249
              SFN   GE P 
Sbjct: 273 LNVSFNNLCGEIPQ 286


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.85
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.85
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.78
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.54
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.42
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.34
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.18
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.1
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.87
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.84
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.42
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.95
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.8
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.33
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.13
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 89.16
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 88.7
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 87.27
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 85.82
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 83.76
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 82.67
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=3.6e-36  Score=312.18  Aligned_cols=262  Identities=25%  Similarity=0.413  Sum_probs=234.2

Q ss_pred             CceecccCCCCCCCCCceeEEEccCCCCCC--CCchhhcCCCCCcEEEccC-CcCCCCCchhhcCCCCCCEEeccCCcCC
Q 007628            1 MGVFCARSPFNSPSLRVVASIDLNHADIAG--YLPPEIGRLTDLAIFHINS-NRFCGVVPSTFRRLKLLYEVDLSNNRFV   77 (595)
Q Consensus         1 ~gv~C~~~~~~~~~l~~L~~LdLs~n~i~~--~lp~~~~~L~~L~~L~Ls~-N~l~~~lp~~~~~L~~L~~L~Ls~N~Ls   77 (595)
                      .||+|+...    ...+|+.|+|++|+|++  .++..|+++.+|++|+|++ |+|.+.++.+|++|.+|++|+|++|+|+
T Consensus        39 ~gv~C~~~~----~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~  114 (313)
T 1ogq_A           39 LGVLCDTDT----QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS  114 (313)
T ss_dssp             TTEEECCSS----SCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCE
T ss_pred             cceEeCCCC----CCceEEEEECCCCCccCCcccChhHhCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeC
Confidence            489997532    12579999999999999  8999999999999999995 9999999999999999999999999999


Q ss_pred             CcCchhcCCCCCCCEEEccCCCCCCCCCccccc-cCCCeeeccCCccccCCCcccCC-C-CceeEEeeccCCCCCcCccc
Q 007628           78 GKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFD-KDLDAIFLNDNRFQFGIPENLGN-S-PVSVLVFANNDLGGCIPGSI  154 (595)
Q Consensus        78 g~lp~~l~~L~~L~~LdLs~N~l~g~ip~~l~~-~~L~~L~L~~N~l~~~~p~~l~~-~-~L~~L~L~~N~l~~~ip~~l  154 (595)
                      +.++..|.++.+|++|||++|+|++.++..+.. .+|++|+|++|++++.++..+.. . .|++|+|++|++++.++..|
T Consensus       115 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~  194 (313)
T 1ogq_A          115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTF  194 (313)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGG
T ss_pred             CcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHH
Confidence            999999999999999999999999988887766 89999999999999888887766 3 79999999999999999999


Q ss_pred             ccccchhhHHHhhccccCCCCCCccCCCccceEEeccCccccCCCCCCcCCCCCccEEEccCCcCCCCCchhccCCCCCc
Q 007628          155 GKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQ  234 (595)
Q Consensus       155 ~~l~~~L~~L~Ls~N~l~g~ip~~~~~L~~L~~LdLs~N~L~g~lP~~l~~L~~L~~L~Ls~N~Lsg~iP~~l~~l~~L~  234 (595)
                      +.+ . |++|+|++|++.+.++..|..+.+|++|+|++|.|++.++. +..+.+|++|+|++|+|++.++.+|.++.+|+
T Consensus       195 ~~l-~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~  271 (313)
T 1ogq_A          195 ANL-N-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLH  271 (313)
T ss_dssp             GGC-C-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCC
T ss_pred             hCC-c-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCC
Confidence            998 4 99999999999999999999999999999999999977665 88899999999999999999999999999999


Q ss_pred             EEEcccccCCCCCCccccccCCCCcccccCCCCCC
Q 007628          235 NFTYSFNYFTGEPPSCTAAAGGGGRMMAARPADCS  269 (595)
Q Consensus       235 ~L~Ls~N~Lsg~~p~~~~~~~~~~~~~~~~~~~c~  269 (595)
                      +|+|++|+|+|.++............+.+|.+.|+
T Consensus       272 ~L~Ls~N~l~~~ip~~~~l~~L~~l~l~~N~~lc~  306 (313)
T 1ogq_A          272 SLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             EEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEES
T ss_pred             EEECcCCcccccCCCCccccccChHHhcCCCCccC
Confidence            99999999999988764444444444555555554



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 595
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-17
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 88.1 bits (217), Expect = 2e-19
 Identities = 44/205 (21%), Positives = 75/205 (36%), Gaps = 15/205 (7%)

Query: 37  GRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFPKLFLSLPKLKYLDLR 96
            +LT+L      +N+   + P        L E+ L+ N+          SL  L  LDL 
Sbjct: 194 AKLTNLESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDLA 249

Query: 97  FNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNDLGGCIPGSIGK 156
            N+     P     K L  + L  N+    I    G + ++ L    N L    P S  K
Sbjct: 250 NNQISNLAPLSGLTK-LTELKLGANQI-SNISPLAGLTALTNLELNENQLEDISPISNLK 307

Query: 157 MGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAH 216
               L    L  +N++   P  +  L  L     + N +     SS+ N+ ++  L+  H
Sbjct: 308 NLTYLT---LYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGH 360

Query: 217 NRFTGVIPSSVCQLPNLQNFTYSFN 241
           N+ + + P  +  L  +     +  
Sbjct: 361 NQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.85
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.39
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.22
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.71
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.58
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=5e-34  Score=292.78  Aligned_cols=259  Identities=25%  Similarity=0.409  Sum_probs=226.3

Q ss_pred             CceecccCCCCCCCCCceeEEEccCCCCCCC--CchhhcCCCCCcEEEccC-CcCCCCCchhhcCCCCCCEEeccCCcCC
Q 007628            1 MGVFCARSPFNSPSLRVVASIDLNHADIAGY--LPPEIGRLTDLAIFHINS-NRFCGVVPSTFRRLKLLYEVDLSNNRFV   77 (595)
Q Consensus         1 ~gv~C~~~~~~~~~l~~L~~LdLs~n~i~~~--lp~~~~~L~~L~~L~Ls~-N~l~~~lp~~~~~L~~L~~L~Ls~N~Ls   77 (595)
                      .||+|+...    ...+|+.|||+++++++.  ++.+|++|++|++|+|++ |+|+|.++.+|++|++|++|+|++|+|.
T Consensus        39 ~gv~C~~~~----~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~  114 (313)
T d1ogqa_          39 LGVLCDTDT----QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS  114 (313)
T ss_dssp             TTEEECCSS----SCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCE
T ss_pred             CCeEEeCCC----CcEEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhcccccc
Confidence            499997542    335799999999999984  789999999999999997 8999999999999999999999999999


Q ss_pred             CcCchhcCCCCCCCEEEccCCCCCCCCCccccc-cCCCeeeccCCccccCCCcccCC-CC-ceeEEeeccCCCCCcCccc
Q 007628           78 GKFPKLFLSLPKLKYLDLRFNEFEGSVPSKLFD-KDLDAIFLNDNRFQFGIPENLGN-SP-VSVLVFANNDLGGCIPGSI  154 (595)
Q Consensus        78 g~lp~~l~~L~~L~~LdLs~N~l~g~ip~~l~~-~~L~~L~L~~N~l~~~~p~~l~~-~~-L~~L~L~~N~l~~~ip~~l  154 (595)
                      +.....+.++.+|++|++++|++.+.++..+.. ..|++++|++|++.+.+++.+.. .. ++.+++++|++++..+..+
T Consensus       115 ~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~  194 (313)
T d1ogqa_         115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTF  194 (313)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGG
T ss_pred             ccccccccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccc
Confidence            999999999999999999999999999887776 78999999999999998887765 33 5889999999999999888


Q ss_pred             ccccchhhHHHhhccccCCCCCCccCCCccceEEeccCccccCCCCCCcCCCCCccEEEccCCcCCCCCchhccCCCCCc
Q 007628          155 GKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPSSIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQ  234 (595)
Q Consensus       155 ~~l~~~L~~L~Ls~N~l~g~ip~~~~~L~~L~~LdLs~N~L~g~lP~~l~~L~~L~~L~Ls~N~Lsg~iP~~l~~l~~L~  234 (595)
                      ..+  .+..+++.+|.+.+.++..++.+.+|+.|++++|.+.+.++ .++.+.+|++|+|++|+|+|.++++|++|.+|+
T Consensus       195 ~~l--~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~  271 (313)
T d1ogqa_         195 ANL--NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLH  271 (313)
T ss_dssp             GGC--CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCC
T ss_pred             ccc--ccccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCC
Confidence            876  34578999999999999999999999999999999997765 688899999999999999999999999999999


Q ss_pred             EEEcccccCCCCCCccccccCCCCcccccCCC
Q 007628          235 NFTYSFNYFTGEPPSCTAAAGGGGRMMAARPA  266 (595)
Q Consensus       235 ~L~Ls~N~Lsg~~p~~~~~~~~~~~~~~~~~~  266 (595)
                      +|||++|+|+|.++............+.+|..
T Consensus       272 ~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~  303 (313)
T d1ogqa_         272 SLNVSFNNLCGEIPQGGNLQRFDVSAYANNKC  303 (313)
T ss_dssp             EEECCSSEEEEECCCSTTGGGSCGGGTCSSSE
T ss_pred             EEECcCCcccccCCCcccCCCCCHHHhCCCcc
Confidence            99999999999998654333333333444433



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure