Citrus Sinensis ID: 007665

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----
MATDHQSNGHCQCCSFLLQVLRGRWFMMFASFLIMAGAGATYLFGTYSKEIKSTLGYDQTTLNLLSTCKDLGANVGVLSGLLAEVTPPWLVLLVGSAMNFGGYFMIWLAVMKKIAKPKVWQMCLYICIGANSQNFANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAVFTQIYLAIYGNDAKSMILLIAWLPALVSLVFVYTIRPLKVSSHPNELKVFYEYLYITISLALCLMGLTIAQKQAHFPHVGYIGSAIAVCIFVFLPLFIAFREEFAAWQQRKQPTPASAVVIVFEQTTLVATKSEILEIESDHSQTLQTENKKQEPDQTPCCGNIFKPPKRGEDYGILQALLSIDMLILFLATFCGLGCSLTAIDNLGQIGESLGYPQHTINTFVSLVSIWNYFGRVFAGFVSEIILLKYKVPRPLIMAISLILSAVGDVLIAFPKPGSVYVASLLVGFSYGAQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYVLNVIVVGRLYDREAMKQLAEKGMTRAMVKDLTCIGRQCYRLSFTILAGVNIFGALITFILVMRTRRYYSGDIYKKFKEQIAAANEKKMAAKQNVSGNT
ccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHccHHcHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHcHHHHHHHccccccccHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHccccEEEccHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
*********HCQCCSFLLQVLRGRWFMMFASFLIMAGAGATYLFGTYSKEIKSTLGYDQTTLNLLSTCKDLGANVGVLSGLLAEVTPPWLVLLVGSAMNFGGYFMIWLAVMKKIAKPKVWQMCLYICIGANSQNFANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAVFTQIYLAIYGNDAKSMILLIAWLPALVSLVFVYTIRPLKVSSHPNELKVFYEYLYITISLALCLMGLTIAQKQAHFPHVGYIGSAIAVCIFVFLPLFIAFREEFAAWQQRK************************************************CCGNIFKPPKRGEDYGILQALLSIDMLILFLATFCGLGCSLTAIDNLGQIGESLGYPQHTINTFVSLVSIWNYFGRVFAGFVSEIILLKYKVPRPLIMAISLILSAVGDVLIAFPKPGSVYVASLLVGFSYGAQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYVLNVIVVGRLYDREAMKQLAEKGMTRAMVKDLTCIGRQCYRLSFTILAGVNIFGALITFILVMRTRRYYSGDIYKKFK*********************
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATDHQSNGHCQCCSFLLQVLRGRWFMMFASFLIMAGAGATYLFGTYSKEIKSTLGYDQTTLNLLSTCKDLGANVGVLSGLLAEVTPPWLVLLVGSAMNFGGYFMIWLAVMKKIAKPKVWQMCLYICIGANSQNFANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAVFTQIYLAIYGNDAKSMILLIAWLPALVSLVFVYTIRPLKVSSHPNELKVFYEYLYITISLALCLMGLTIAQKQAHFPHVGYIGSAIAVCIFVFLPLFIAFREEFAAWQQRKQPTPASAVVIVFEQTTLVATKSEILEIESDHSQTLQTENKKQEPDQTPCCGNIFKPPKRGEDYGILQALLSIDMLILFLATFCGLGCSLTAIDNLGQIGESLGYPQHTINTFVSLVSIWNYFGRVFAGFVSEIILLKYKVPRPLIMAISLILSAVGDVLIAFPKPGSVYVASLLVGFSYGAQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYVLNVIVVGRLYDREAMKQLAEKGMTRAMVKDLTCIGRQCYRLSFTILAGVNIFGALITFILVMRTRRYYSGDIxxxxxxxxxxxxxxxxxxxxxVSGNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:confident
Coverage over the Query: 19-179,212-232,265-293,307-310,339-508,533-546
View the alignment between query and template
View the model in PyMOL
Template: 3O7Q, chain A
Confidence level:confident
Coverage over the Query: 22-234,264-272,284-287,318-322,333-509,533-549
View the alignment between query and template
View the model in PyMOL
Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 25-202,269-315,334-513,532-573
View the alignment between query and template
View the model in PyMOL
Template: 4APS, chain A
Confidence level:confident
Coverage over the Query: 46-276,351-508,534-541
View the alignment between query and template
View the model in PyMOL