Citrus Sinensis ID: 007666


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----
MGASYLVISAASTILSFVGLQFWTEFSLDKLRTDGLVVENVIHLESANRVLELLLRSYATVALLANFVLNVFVLINLCLKTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEGSPWRLSSYISMNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAHARSTSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccEEEcccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHccc
***SYLVISAASTILSFVGLQFWTEFSLDKLRTDGLVVENVIHLESANRVLELLLRSYATVALLANFVLNVFVLINLCLKTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFV*********************************************************************************************GLSRVQMMMRHLASVGETYAQTAIEDTSWSLW*****************************************IANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGASYLVISAASTILSFVGLQFWTEFSLDKLRTDGLVVENVIHLESANRVLELLLRSYATVALLANFVLNVFVLINLCLKTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEGSPWRLSSYISMNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAHARSTSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin protein ligase RIN2 E3 ubiquitin protein ligase that acts as positive regulator of RPM1- and RPS2-dependent hypersensitive response (HR), in association with RIN3. Probably not required for RPM1 degradation during HR.confidentQ8VYC8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ECT, chain A
Confidence level:very confident
Coverage over the Query: 333-386
View the alignment between query and template
View the model in PyMOL
Template: 2EJS, chain A
Confidence level:confident
Coverage over the Query: 554-593
View the alignment between query and template
View the model in PyMOL
Template: 1FP0, chain A
Confidence level:probable
Coverage over the Query: 318-391
View the alignment between query and template
View the model in PyMOL