Citrus Sinensis ID: 007666
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 594 | ||||||
| 255539769 | 585 | protein binding protein, putative [Ricin | 0.984 | 1.0 | 0.779 | 0.0 | |
| 225466103 | 587 | PREDICTED: E3 ubiquitin protein ligase R | 0.988 | 1.0 | 0.767 | 0.0 | |
| 224071523 | 581 | predicted protein [Populus trichocarpa] | 0.978 | 1.0 | 0.745 | 0.0 | |
| 224125224 | 571 | predicted protein [Populus trichocarpa] | 0.959 | 0.998 | 0.750 | 0.0 | |
| 357455727 | 589 | E3 ubiquitin-protein ligase synoviolin [ | 0.988 | 0.996 | 0.719 | 0.0 | |
| 356508268 | 586 | PREDICTED: E3 ubiquitin protein ligase R | 0.986 | 1.0 | 0.725 | 0.0 | |
| 356517740 | 586 | PREDICTED: E3 ubiquitin protein ligase R | 0.986 | 1.0 | 0.725 | 0.0 | |
| 22328916 | 578 | E3 ubiquitin protein ligase RIN2 [Arabid | 0.973 | 1.0 | 0.703 | 0.0 | |
| 297792453 | 577 | predicted protein [Arabidopsis lyrata su | 0.971 | 1.0 | 0.705 | 0.0 | |
| 297803598 | 578 | hypothetical protein ARALYDRAFT_492309 [ | 0.973 | 1.0 | 0.708 | 0.0 |
| >gi|255539769|ref|XP_002510949.1| protein binding protein, putative [Ricinus communis] gi|223550064|gb|EEF51551.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 947 bits (2448), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 463/594 (77%), Positives = 517/594 (87%), Gaps = 9/594 (1%)
Query: 1 MGASYLVISAASTILSFVGLQFWTEFSLDKLRTDGLVVENVIHLESANRVLELLLRSYAT 60
MGA YL ISAA T LSFVGL+ WTE SL+KL+++GL+ EN I+ E+ANR LELLL SYAT
Sbjct: 1 MGAGYLAISAACTALSFVGLKCWTELSLEKLKSEGLISENFINPENANRALELLLGSYAT 60
Query: 61 VALLANFVLNVFVLINLCLKTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQ 120
+ALLA+FV N F+L+NL LKTIFF ELYP+ETRK +ERL+NYVIYKGTFLPLVIP T+FQ
Sbjct: 61 IALLASFVFNAFILLNLSLKTIFFAELYPSETRKLMERLVNYVIYKGTFLPLVIPATIFQ 120
Query: 121 AGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMC 180
AGLWS WLTVLCSLKMFQALARDRLERLNASPSA PWTYFRV+S LL VL+VD FWIR+C
Sbjct: 121 AGLWSSWLTVLCSLKMFQALARDRLERLNASPSAMPWTYFRVYSVLLLVLSVDFFWIRLC 180
Query: 181 LLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDT 240
L+++TLD+SMF+LLF+EP S+AFETMQA+LVHGFQLLDIW HHSAGN NC R KFFD
Sbjct: 181 WLIYRTLDTSMFMLLFYEPFSIAFETMQAMLVHGFQLLDIWFHHSAGNDANCQRFKFFDP 240
Query: 241 LAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLS 300
+AAGSL EWKGILIRN GF LDMATLLMALGHY+HIWWL G+AFHLVDA+LFLNIRALLS
Sbjct: 241 IAAGSLSEWKGILIRNLGFSLDMATLLMALGHYMHIWWLHGVAFHLVDAVLFLNIRALLS 300
Query: 301 AIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLA 360
AIIKR++GF+KLRIALG LHAALPDATSEELRAYDDECAICREPMAKAKKL C+HLFHLA
Sbjct: 301 AIIKRVRGFVKLRIALGALHAALPDATSEELRAYDDECAICREPMAKAKKLHCSHLFHLA 360
Query: 361 CLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTG 420
CLRSWLDQGLNEMYSCPTCRKPLFVGR + E + +VS+DEQLARQ+S GLD+QN
Sbjct: 361 CLRSWLDQGLNEMYSCPTCRKPLFVGRPDNEPSRHRRDVSADEQLARQISEGLDQQN--A 418
Query: 421 QTLPTGVFPNQTQPPVEGSPWRLSSYISMNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGL 480
TLP GVFPNQ + +EGSPWR +AGLDSSWLH W QGVDGAGPSTAMRSVGL
Sbjct: 419 PTLPAGVFPNQMRNSIEGSPWR-------SAGLDSSWLHTWQGQGVDGAGPSTAMRSVGL 471
Query: 481 SRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAH 540
RVQMMMRHLASVGETYAQTA+ED++WSLWPMNP Q ASGS VPPA GR G TGG H
Sbjct: 472 GRVQMMMRHLASVGETYAQTALEDSAWSLWPMNPPQGVASGSLVPPATGGRSAGGTGGLH 531
Query: 541 ARSTSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM 594
RS SRSAN+N+AN+LAMAETVREVLPH+P++LI QDLQRTNS T+TVNNLLQM
Sbjct: 532 MRSPSRSANDNVANLLAMAETVREVLPHIPDELILQDLQRTNSVTVTVNNLLQM 585
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225466103|ref|XP_002266334.1| PREDICTED: E3 ubiquitin protein ligase RIN2 [Vitis vinifera] gi|296084203|emb|CBI24591.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224071523|ref|XP_002303501.1| predicted protein [Populus trichocarpa] gi|222840933|gb|EEE78480.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224125224|ref|XP_002329924.1| predicted protein [Populus trichocarpa] gi|222871161|gb|EEF08292.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357455727|ref|XP_003598144.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] gi|355487192|gb|AES68395.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356508268|ref|XP_003522880.1| PREDICTED: E3 ubiquitin protein ligase RIN2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356517740|ref|XP_003527544.1| PREDICTED: E3 ubiquitin protein ligase RIN2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|22328916|ref|NP_194253.2| E3 ubiquitin protein ligase RIN2 [Arabidopsis thaliana] gi|30686808|ref|NP_849552.1| E3 ubiquitin protein ligase RIN2 [Arabidopsis thaliana] gi|75304438|sp|Q8VYC8.1|RIN2_ARATH RecName: Full=E3 ubiquitin protein ligase RIN2; AltName: Full=AMF receptor-like protein 1A; AltName: Full=RPM1-interacting protein 2 gi|18176187|gb|AAL60000.1| unknown protein [Arabidopsis thaliana] gi|332659628|gb|AEE85028.1| E3 ubiquitin protein ligase RIN2 [Arabidopsis thaliana] gi|332659629|gb|AEE85029.1| E3 ubiquitin protein ligase RIN2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297792453|ref|XP_002864111.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309946|gb|EFH40370.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297803598|ref|XP_002869683.1| hypothetical protein ARALYDRAFT_492309 [Arabidopsis lyrata subsp. lyrata] gi|297315519|gb|EFH45942.1| hypothetical protein ARALYDRAFT_492309 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 594 | ||||||
| TAIR|locus:2122674 | 578 | RIN2 "RPM1 interacting protein | 0.973 | 1.0 | 0.670 | 1.6e-214 | |
| RGD|1311551 | 643 | Amfr "autocrine motility facto | 0.249 | 0.230 | 0.325 | 3.4e-25 | |
| TAIR|locus:2093422 | 492 | Hrd1A "homolog of yeast Hrd1" | 0.262 | 0.317 | 0.341 | 4.2e-23 | |
| UNIPROTKB|F1MWZ9 | 646 | AMFR "Uncharacterized protein" | 0.257 | 0.236 | 0.348 | 1e-22 | |
| ZFIN|ZDB-GENE-040426-2190 | 620 | amfr "autocrine motility facto | 0.223 | 0.214 | 0.374 | 2e-22 | |
| MGI|MGI:1345634 | 643 | Amfr "autocrine motility facto | 0.257 | 0.237 | 0.348 | 2.9e-22 | |
| TAIR|locus:2014993 | 460 | Hrd1B "homolog of yeast Hrd1" | 0.289 | 0.373 | 0.305 | 5.9e-22 | |
| UNIPROTKB|F1PK72 | 560 | AMFR "Uncharacterized protein" | 0.257 | 0.273 | 0.335 | 7.5e-22 | |
| UNIPROTKB|Q9UKV5 | 643 | AMFR "E3 ubiquitin-protein lig | 0.257 | 0.237 | 0.341 | 8.1e-22 | |
| UNIPROTKB|H3BRK9 | 288 | AMFR "E3 ubiquitin-protein lig | 0.193 | 0.399 | 0.375 | 3.7e-21 |
| TAIR|locus:2122674 RIN2 "RPM1 interacting protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2073 (734.8 bits), Expect = 1.6e-214, P = 1.6e-214
Identities = 398/594 (67%), Positives = 463/594 (77%)
Query: 1 MGASYLVISAASTILSFVGLQFWTEFSLDKLRTDGLVVENVIHLESANRVLELLLRSYAT 60
MG YL +S AST LSFVGLQ WTE SLD+LR DGL+ +N I L + LELLL SY T
Sbjct: 1 MGIKYLPVSVASTALSFVGLQVWTELSLDRLRADGLIAKN-ISLGDSEHALELLLGSYFT 59
Query: 61 XXXXXXXXXXXXXXINLCLKTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQ 120
+ L LKT+FFG+LY ET+K VERL NY+IYKGTFLPLVIPPT+FQ
Sbjct: 60 IALLTNFVLNVYILLVLSLKTLFFGDLYDVETKKLVERLANYIIYKGTFLPLVIPPTIFQ 119
Query: 121 AGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMC 180
LW+VWLTVLC+LKMFQALARDRLERLNASPS+TPWTYFRV+S L VL+VD+FWI++
Sbjct: 120 GVLWTVWLTVLCTLKMFQALARDRLERLNASPSSTPWTYFRVYSVLFLVLSVDMFWIKLS 179
Query: 181 LLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDT 240
L+ + T+ S+++LLL FEP S+AFET+QA+L+HGFQLLD+W++H A +++C RSKF D+
Sbjct: 180 LMTYNTIGSAVYLLLLFEPCSIAFETLQALLIHGFQLLDMWINHLAVKNSDCQRSKFIDS 239
Query: 241 LAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLS 300
+ AGSLLEWKG+L RN GFFLDMATL+MALGHY+HIWWL G+AFHLVDA+LFLNIRALLS
Sbjct: 240 MTAGSLLEWKGLLNRNLGFFLDMATLVMALGHYLHIWWLHGIAFHLVDAVLFLNIRALLS 299
Query: 301 AIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLA 360
AI+KRIKG+IKLRIALG LHAALPDATSEELRAYDDECAICREPMAKAK+L CNHLFHL
Sbjct: 300 AILKRIKGYIKLRIALGALHAALPDATSEELRAYDDECAICREPMAKAKRLHCNHLFHLG 359
Query: 361 CLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTG 420
CLRSWLDQGLNE+YSCPTCRKPLFVGR E E N R EVSSDEQLARQL +RQNN
Sbjct: 360 CLRSWLDQGLNEVYSCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQL----ERQNNPV 415
Query: 421 QTLPTGVFPNQTQPPVEGSPWRLSSYISMNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGL 480
L TG+FP + VE S N GLD SWL W SQG D AGPST R+VGL
Sbjct: 416 HALATGLFPAEVPDSVENDT-------SRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGL 468
Query: 481 SRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNXXXXXXXXXXXXXXXXXRHPGNTGGAH 540
RVQMMMRHLASVGE+YAQTA++D +WSLWPMN + G TGG H
Sbjct: 469 GRVQMMMRHLASVGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPG----NGGRTGGLH 524
Query: 541 ARSTSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM 594
R+ S + NE++ NILAMAETVREV+PH+P+++IFQDLQRTNS +TVNNLLQM
Sbjct: 525 LRTVSNTTNESLTNILAMAETVREVMPHVPDEIIFQDLQRTNSVAVTVNNLLQM 578
|
|
| RGD|1311551 Amfr "autocrine motility factor receptor, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093422 Hrd1A "homolog of yeast Hrd1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MWZ9 AMFR "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2190 amfr "autocrine motility factor receptor" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1345634 Amfr "autocrine motility factor receptor" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014993 Hrd1B "homolog of yeast Hrd1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PK72 AMFR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKV5 AMFR "E3 ubiquitin-protein ligase AMFR" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BRK9 AMFR "E3 ubiquitin-protein ligase AMFR" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_III000319 | hypothetical protein (581 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 594 | |||
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 7e-18 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 6e-13 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 7e-13 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 1e-09 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 4e-09 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-08 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 2e-08 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 2e-06 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 8e-05 | |
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 2e-04 | |
| smart00546 | 43 | smart00546, CUE, Domain that may be involved in bi | 2e-04 | |
| pfam02845 | 42 | pfam02845, CUE, CUE domain | 2e-04 | |
| pfam12861 | 85 | pfam12861, zf-Apc11, Anaphase-promoting complex su | 4e-04 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 0.004 |
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 86.6 bits (214), Expect = 7e-18
Identities = 88/410 (21%), Positives = 145/410 (35%), Gaps = 78/410 (19%)
Query: 57 SYATVALLANFVLNVFVLINLCLKTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPP 116
S + + N +L +F LI LKT+ FG L E E+L + L +
Sbjct: 39 SPVHITIGLNVILLLFFLIANALKTLLFGSLRTFELELLYEQLWITLT---EILLAI--- 92
Query: 117 TVFQAGL---WSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAV- 172
+VF+ + + + L+ L K+F + R ERL + + F FS F+L++
Sbjct: 93 SVFREAISFSFFMLLSTLLFAKVFHWILSFRTERLQIQSTDQRFHIFSRFSCAYFLLSIL 152
Query: 173 DIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNC 232
D I +C+ +D S L LF SV + + ST
Sbjct: 153 DASLIYLCISSEHLIDKST-LFLFVCEFSVLLLNLTSEANKLCVYNYEARDDDDERST-- 209
Query: 233 ARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAI-- 290
+ F L++ Y + L +
Sbjct: 210 ------------------------YLFRLEVC--------YDGLTLLAYSLLFMYQFPYV 237
Query: 291 -----LFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPM 345
L + A+ +RI+ + R A L+A P AT E+L D C IC + M
Sbjct: 238 RVPIYLIRQMYTCFYALFRRIREHARFRRATKDLNAMYPTATEEQLTNSDRTCTICMDEM 297
Query: 346 -------------AKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEA 392
K+L C H+ HL CL++WL++ +CP CR+P+ + +
Sbjct: 298 FHPDHEPLPRGLDMTPKRLPCGHILHLHCLKNWLER----QQTCPICRRPVIFDQS---S 350
Query: 393 NSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQ--PPVEGSP 440
+ + Q+A Q+ +NT T N + P +
Sbjct: 351 PTPASPNVRNTQIATQVPN----PDNTPTTTAVPGITNSSNQGDPQASTF 396
|
Length = 491 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|214715 smart00546, CUE, Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >gnl|CDD|202430 pfam02845, CUE, CUE domain | Back alignment and domain information |
|---|
| >gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 594 | |||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 100.0 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 100.0 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.35 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.16 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 99.02 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.98 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.97 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.92 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.9 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.9 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.73 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.72 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.69 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.69 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.65 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.61 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.52 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 98.52 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.51 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.45 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.44 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.42 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.42 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.39 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.37 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.25 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 98.25 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.21 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.18 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 98.15 | |
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 98.15 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.12 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.1 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.07 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.99 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.91 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.83 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.68 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.67 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.66 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 97.64 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.63 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.55 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.54 | |
| PF13705 | 508 | TRC8_N: TRC8 N-terminal domain | 97.54 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.47 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.47 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 97.46 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.44 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.42 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.37 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.36 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.2 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.04 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.88 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.83 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.79 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.69 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.66 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.53 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.47 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.42 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.29 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.18 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 96.17 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 96.07 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.94 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.87 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 95.86 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 95.6 | |
| PF11547 | 53 | E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro | 95.53 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.5 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 95.3 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 95.05 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.01 | |
| PHA02862 | 156 | 5L protein; Provisional | 94.88 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 94.63 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 94.49 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 94.37 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 93.69 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.55 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 93.55 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 93.09 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 92.97 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 92.53 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 92.44 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.97 | |
| PHA03096 | 284 | p28-like protein; Provisional | 91.58 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 91.13 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 90.98 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.81 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 90.2 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 90.07 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 90.04 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 89.94 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 89.32 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 89.01 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 88.94 | |
| KOG0943 | 3015 | consensus Predicted ubiquitin-protein ligase/hyper | 87.78 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.7 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 86.65 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 86.3 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 85.27 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 85.16 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 84.42 | |
| KOG0801 | 205 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.75 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 83.27 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.15 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.81 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 81.17 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 80.34 |
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-41 Score=340.61 Aligned_cols=326 Identities=24% Similarity=0.362 Sum_probs=237.3
Q ss_pred HHHHHHHhhhhHhhhhhhhcccccCceeccccccchhHHHHHHHHh-chhHHHHHHHHHHHHHHHHHHHHHHHHcccCcH
Q 007666 11 ASTILSFVGLQFWTEFSLDKLRTDGLVVENVIHLESANRVLELLLR-SYATVALLANFVLNVFVLINLCLKTIFFGELYP 89 (594)
Q Consensus 11 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~-s~~~v~vL~N~~~~~~~ll~~~lq~lfFG~LR~ 89 (594)
+|...+++++....+-++. .....|++++.-+| |.++++++.|++++++.++++++++++||+||.
T Consensus 5 ~y~l~~~Vl~~l~~~~~~~-------------~s~t~ys~l~~t~~ls~~hi~i~~~~ill~~~l~~~~l~~llFGsLr~ 71 (491)
T COG5243 5 LYVLASLVLFGLSVLLSLY-------------SSATVYSALVMTSQLSPVHITIGLNVILLLFFLIANALKTLLFGSLRT 71 (491)
T ss_pred ehhHHHHHHHHHHHHHHHh-------------ccceeeeeeeeeeccCcchhHHHHHHHHHHHHHHHHHHHHHhhhhhHH
Confidence 3555666666555555443 34455667777777 899999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHhhcccccccchhhhHHHHHHHHHHHHHHHHHHHhhhhhhhhhcCCCCCcchh--HHHHHHHH
Q 007666 90 AETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTY--FRVFSALL 167 (594)
Q Consensus 90 ~E~e~L~er~~~f~~~k~~fl~~vi~~~~~~~~~w~~wF~~L~~LK~fh~L~~dRve~L~~SP~~~~~~h--~Rl~~lL~ 167 (594)
.|.|+++|++| |++. ++.++..++++.... .+..++..|+++|+||||+++|+|.+. -.++..+.| -|..+.++
T Consensus 72 ~E~e~~~E~l~-~tlt-~~ll~iS~F~e~i~f-s~~~l~~~Ll~~kvfhwil~~R~er~~-~~st~~~~~ifSrfS~~~~ 147 (491)
T COG5243 72 FELELLYEQLW-ITLT-EILLAISVFREAISF-SFFMLLSTLLFAKVFHWILSFRTERLQ-IQSTDQRFHIFSRFSCAYF 147 (491)
T ss_pred HHHHHHHHhhH-HHHH-HHHHHHHHHHhhHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH
Confidence 99999999999 4443 444455555553221 245677888999999999999999863 223444444 59999999
Q ss_pred HHHHHHHHHHHHHHHHHhhCCCchhHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhccCCcccccchhhhhhccccch
Q 007666 168 FVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLL 247 (594)
Q Consensus 168 ~ll~~d~~~i~~~~~~~~~~g~s~~ll~~fE~~~l~~~tl~~ll~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~g~~w 247 (594)
++.++|..+|..|+..-...+.++..++..|+..+ ...++.. ++..+... ++.++ .-
T Consensus 148 lL~ild~~li~~CiSs~~liD~~~lfL~~c~F~~~-ll~l~s~-----------------~n~~cV~n--~~~~d---dD 204 (491)
T COG5243 148 LLSILDASLIYLCISSEHLIDKSTLFLFVCEFSVL-LLNLTSE-----------------ANKLCVYN--YEARD---DD 204 (491)
T ss_pred HHHHHhHHHHHHHhhhHhhhhhhHHHHHHHHHHHH-HHHHHHh-----------------hcccceee--ccccc---cc
Confidence 99999999999998654333333333333343221 1111110 01011000 00000 01
Q ss_pred hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCc
Q 007666 248 EWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDAT 327 (594)
Q Consensus 248 e~kg~~i~y~~f~~dl~~l~~~l~~~l~~~~~~g~~~~lv~~vl~l~ir~~~~~l~~r~~~~~~~r~~~~~l~~~~p~~~ 327 (594)
+.|..+.+|.++..|=++++.+...+...+..+.+|+.+++.++ .. +.++.+|++.+.+++++.|.+++.+|.++
T Consensus 205 d~rs~~~f~~~v~y~g~tllays~l~~~~~~~~r~Pi~l~r~~~-t~----~~AL~~~i~~~~~~~r~~kdl~~~~~t~t 279 (491)
T COG5243 205 DERSTYLFRLEVCYDGLTLLAYSLLFMYQFPYVRVPIYLIRQMY-TC----FYALFRRIREHARFRRATKDLNAMYPTAT 279 (491)
T ss_pred ccceeeeeeeehHHHHHHHHHHHHHHHhhccchhchHHHHHHHH-HH----HHHHHHHHHHHHHHHHHhhHHHhhcchhh
Confidence 34566667788888888888887777777777889999888753 33 34677899999999999999999999999
Q ss_pred hhhhhcCCCccccccccc-c------------cccccccCCccchhhHHHHHHcCCCCCCCCcCcccCCcC
Q 007666 328 SEELRAYDDECAICREPM-A------------KAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFV 385 (594)
Q Consensus 328 ~eel~~~~~~C~IC~e~~-~------------~~~~lpCgH~Fh~~Cl~~wl~~~~~~~~~CP~CR~~~~~ 385 (594)
.|++...|..|.||+|++ . .||+|||||++|.+|++.|+++ +++||+||.++.-
T Consensus 280 ~eql~n~D~~C~ICmde~~h~~~~~~~~~~~~~pKrLpCGHilHl~CLknW~ER----qQTCPICr~p~if 346 (491)
T COG5243 280 EEQLTNSDRTCTICMDEMFHPDHEPLPRGLDMTPKRLPCGHILHLHCLKNWLER----QQTCPICRRPVIF 346 (491)
T ss_pred hhhhcCCCCeEEEecccccCCCCccCcccccCCcccccccceeeHHHHHHHHHh----ccCCCcccCcccc
Confidence 999998999999999995 3 3589999999999999999999 7999999999644
|
|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13705 TRC8_N: TRC8 N-terminal domain | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF11547 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro: IPR024725 EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated (UBA) domain which binds ubiquitin | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 594 | ||||
| 2ect_A | 78 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 2e-06 |
| >pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 594 | |||
| 2ejs_A | 58 | Autocrine motility factor receptor, isoform 2; CUE | 5e-15 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 2e-14 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 8e-14 | |
| 2ekf_A | 61 | Ancient ubiquitous protein 1; CUE, ubiquitin ligas | 8e-14 | |
| 4g3o_A | 58 | E3 ubiquitin-protein ligase AMFR; all-helical stru | 2e-13 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 3e-13 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 7e-13 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 3e-12 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 3e-12 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 9e-12 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 2e-11 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 4e-11 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 7e-11 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 9e-11 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 2e-10 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 3e-10 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 3e-10 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 1e-09 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 2e-09 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 3e-09 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 3e-09 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 5e-09 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 7e-09 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 8e-09 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 9e-09 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 1e-08 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 2e-08 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 3e-08 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 6e-08 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 7e-08 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 8e-08 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 1e-07 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 1e-07 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 1e-07 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 3e-07 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 3e-07 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 4e-07 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 4e-07 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 5e-07 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 9e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 2e-06 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 2e-06 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 3e-06 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 5e-06 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 4e-06 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 4e-06 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 4e-06 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 5e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 5e-06 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 6e-06 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 1e-05 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 2e-05 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 2e-05 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 5e-05 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 6e-05 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 9e-05 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 1e-04 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 1e-04 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 2e-04 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 2e-04 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 3e-04 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 3e-04 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 3e-04 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 3e-04 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 4e-04 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 4e-04 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 5e-04 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 6e-04 |
| >2ejs_A Autocrine motility factor receptor, isoform 2; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
Score = 68.7 bits (168), Expect = 5e-15
Identities = 19/50 (38%), Positives = 32/50 (64%)
Query: 544 TSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQ 593
+S S+ + + + AMA ++E+ P +P L+ QDLQ T S IT +N+L+
Sbjct: 2 SSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILE 51
|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2ekf_A Ancient ubiquitous protein 1; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >4g3o_A E3 ubiquitin-protein ligase AMFR; all-helical structure, BAG6; 1.60A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 594 | |||
| 2ejs_A | 58 | Autocrine motility factor receptor, isoform 2; CUE | 99.64 | |
| 2ekf_A | 61 | Ancient ubiquitous protein 1; CUE, ubiquitin ligas | 99.64 | |
| 4g3o_A | 58 | E3 ubiquitin-protein ligase AMFR; all-helical stru | 99.51 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.21 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.21 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.19 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.18 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.18 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.18 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.17 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.17 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.17 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.17 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.16 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.15 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.15 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.14 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.12 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.12 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.12 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.08 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.08 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.07 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.05 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.04 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.01 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.01 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.99 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.99 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.98 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.98 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.97 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.97 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.95 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.95 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.94 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.91 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.91 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.88 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.87 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.86 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.86 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.84 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.84 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.84 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.84 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.82 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.81 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.81 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.8 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.78 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.77 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.75 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.73 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.73 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.72 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.71 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.69 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.63 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.59 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.57 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.51 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.49 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.49 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.37 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.27 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.27 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.26 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.22 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.14 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.03 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.73 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.27 | |
| 2dhy_A | 67 | CUE domain-containing protein 1; structural genomi | 96.77 | |
| 2di0_A | 71 | Activating signal cointegrator 1 complex subunit 2 | 96.41 | |
| 2qho_B | 53 | E3 ubiquitin-protein ligase EDD1; protein-protein | 95.95 | |
| 1wgl_A | 59 | TOLL-interacting protein; CUE domain, structural g | 93.19 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 91.69 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 91.61 | |
| 1p3q_Q | 54 | VPS9P, vacuolar protein sorting-associated protein | 91.35 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 90.79 | |
| 1otr_A | 49 | Protein CUE2; protein-protein complex, cell cycle; | 89.62 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 88.76 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 85.16 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 84.58 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 82.86 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 82.67 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 82.14 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 81.61 |
| >2ejs_A Autocrine motility factor receptor, isoform 2; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.64 E-value=8.1e-17 Score=123.85 Aligned_cols=50 Identities=38% Similarity=0.601 Sum_probs=47.3
Q ss_pred cccccccchHHHHHHHHHHHhhCCCCChHHHHHHhhccCchhhhHHhhhc
Q 007666 544 TSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQ 593 (594)
Q Consensus 544 ~~~~~~~~~~~~~~~~~~v~~~~p~~p~~~~~~~~~~~~~~~~~~~~~~~ 593 (594)
++|.++++++|+.+|+++|+|||||+|.+.|++||++||||++|++||||
T Consensus 2 ~~~~~~~~~~q~~~mv~~V~~mfP~vp~~~I~~DL~~TgsVe~TienILe 51 (58)
T 2ejs_A 2 SSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILE 51 (58)
T ss_dssp CCCCSSCCCCHHHHHHHHHHHHCCSSCHHHHHHHHHHHCSHHHHHHHHHH
T ss_pred CCCcCCcchHHHHHHHHHHHHHcCCCCHHHHHHHHHHhCCHHHHHHHHHh
Confidence 45678888999999999999999999999999999999999999999997
|
| >2ekf_A Ancient ubiquitous protein 1; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4g3o_A E3 ubiquitin-protein ligase AMFR; all-helical structure, BAG6; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >2qho_B E3 ubiquitin-protein ligase EDD1; protein-protein complex, protein binding/ligase complex; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 594 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 7e-13 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 9e-13 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-12 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 7e-12 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 5e-10 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 6e-10 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-09 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 2e-09 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 4e-09 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 1e-08 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 1e-08 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 2e-07 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 3e-07 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 2e-06 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 4e-06 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 8e-06 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 2e-05 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 2e-05 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 2e-05 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 2e-04 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 4e-04 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 0.004 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 0.004 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 61.9 bits (150), Expect = 7e-13
Identities = 19/64 (29%), Positives = 23/64 (35%), Gaps = 9/64 (14%)
Query: 326 ATSEELRAY------DDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTC 379
T E+ Y C IC E K C HL +CL SW + CP C
Sbjct: 8 VTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQ---GCPFC 64
Query: 380 RKPL 383
R +
Sbjct: 65 RCEI 68
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 594 | |||
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.29 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.25 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.24 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.16 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.13 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.11 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.11 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.08 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.08 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.06 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.02 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.94 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.91 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.81 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.78 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.51 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.81 | |
| d2di0a1 | 63 | Activating signal cointegrator 1 complex subunit 2 | 95.51 | |
| d1mn3a_ | 54 | Vacuolar protein sorting-associated protein vps9 { | 92.51 | |
| d1wgla_ | 59 | Toll-interacting protein {Human (Homo sapiens) [Ta | 91.94 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 91.11 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 87.62 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 86.14 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 85.37 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 83.52 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 82.67 |
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Immediate early protein, IEEHV species: Equine herpesvirus 1 [TaxId: 10326]
Probab=99.29 E-value=7.5e-13 Score=104.78 Aligned_cols=48 Identities=31% Similarity=0.766 Sum_probs=42.0
Q ss_pred CCCcccccccccccc-cccccCCccchhhHHHHHHcCCCCCCCCcCcccCCcC
Q 007666 334 YDDECAICREPMAKA-KKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFV 385 (594)
Q Consensus 334 ~~~~C~IC~e~~~~~-~~lpCgH~Fh~~Cl~~wl~~~~~~~~~CP~CR~~~~~ 385 (594)
..+.|+||++.+.++ +.+||||.||..|+..|+++ +.+||+||+++..
T Consensus 4 ~~d~C~IC~~~~~~~~~~~~C~H~Fc~~Ci~~w~~~----~~~CP~CR~~i~~ 52 (68)
T d1chca_ 4 VAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQ----NPTCPLCKVPVES 52 (68)
T ss_dssp CCCCCSSCCSCCCSCEEETTTTEEESTTHHHHHHHH----SCSTTTTCCCCCC
T ss_pred CCCCCccCCcCccCCcEEeCCCCcCcHHHHHHHHHh----CCcCCCCCcchHh
Confidence 456899999999876 45799999999999999998 6899999998754
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|