Citrus Sinensis ID: 007669

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----

MEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISDDEDDEPKKEEEGDVEDVDEEKEKEGKKKKKIKEVSHEWQLINKQKPIWLRKPEEITKEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDTRKKMNNIKLYVRRVFIMDNCEELIPEYLGFIKGVVDSDDLPLNISREMLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYNKFYDAFSKNLKLGIHEDSQNRAKLADLLRYHSTKSSEEFTSLKDYVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYEGKKLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTMKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLTMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEEENADEDIDMPALEEDGAEESKMEEVD

cccccccccccccccccccccccEEEccEEEEEEcccccccEEEEEcccccEEEEEccccccccccEEEEEEEcccHHHHHcHHHHHHHHHHccccccccEEEEEEEECccccccccccccccccccccccccHHHHHHccccccEEEEEEEEEEEcccccccccccccccHHHHHHHHHHccccccccccEEEEEEEEEEEEEEEEECccccccccccccccccccEEEEEEEEEEcccccccccccccccCECcccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccHHHHHHccccccccEEEEEcccHHHHHccHHHHHHHHcccEEEEccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccEEEEEccccccHHHHHHHHHccccccccccccccccCEEEccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc

******GADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTT****************************************SHEWQLINKQKPIWLRKPEEITKEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDTRKKMNNIKLYVRRVFIMDNCEELIPEYLGFIKGVVDSDDLPLNISREMLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYNKFYDAFSKNLKLGIHEDSQNRAKLADLLRYHSTKSSEEFTSLKDYVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYEGKKLVSATK************************NLCKTMKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWSANMERIM******************TMEINPDNGIMEELRKRAE**KNDKSVKDLTMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLS******************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISDDEDDEPKKEEEGDVEDVDEEKEKEGKKKKKIKEVSHEWQLINKQKPIWLRKPEEITKEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDTRKKMNNIKLYVRRVFIMDNCEELIPEYLGFIKGVVDSDDLPLNISREMLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYNKFYDAFSKNLKLGIHEDSQNRAKLADLLRYHSTKSSEEFTSLKDYVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYEGKKLVSATKEGLKLxxxxxxxxxxxxxxxxxxxxxCKTMKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLTMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEEENADEDIDMPALEEDGAEESKMEEVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Heat shock protein 82 (Fragment)	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.	confident	P36182
Heat shock protein 81-2	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.	confident	Q69QQ6
Heat shock protein 81-1	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.	confident	Q0J4P2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CG9, chain A
Confidence level:very confident
Coverage over the Query: 156-485,499-564
View the alignment between query and template
View the model in PyMOL