Citrus Sinensis ID: 007736

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-
MTELPQAQGKTLPDAWDYKGRPAERSKTGGWTSAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTISTIIPSLRPPKCNLNHGQSCIQASGMQLVVLYIALYLTALGTGGLKSSVSGFGSDQFDDSDPQERNQMTNFFNWFFFFISIGSLAAVTVLVYIQDNLGREWGYGICACAIVFGLVVFLSGTRRYRFKKLVGSPLTQIASVFVVAWRKRHLDLPSDPSMFFNIDDIPVEGKKTKQRLPHTKQFRFLDKAAIFKDSDMSNSTTVVINKWNLATLTDVEEVKMVIRMLPIWATTIIFWTVYAQMTTFSVSQATTMNRHIGSFEIPGASLTFFFVGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAARSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHKVTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKRLAEEGIELEEPEPACH
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHEEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccCECccccHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
***************WDYKGRPA*****GGWTSAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTISTIIPSLRPPKCNLNHGQSCIQASGMQLVVLYIALYLTALGTGGLKSSVSGFGSDQFDDSDPQERNQMTNFFNWFFFFISIGSLAAVTVLVYIQDNLGREWGYGICACAIVFGLVVFLSGTRRYRFKKLVGSPLTQIASVFVVAWRKRHLDLPSDPSMFFNIDDIPVE*******LPHTKQFRFLDKAAIFKDSDMSNSTTVVINKWNLATLTDVEEVKMVIRMLPIWATTIIFWTVYAQMTTFSVSQATTMNRHIGSFEIPGASLTFFFVGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAARSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHKVTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDK*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTELPQAQGKTLPDAWDYKGRPAERSKTGGWTSAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTISTIIPSLRPPKCNLNHGQSCIQASGMQLVVLYIALYLTALGTGGLKSSVSGFGSDQFDDSDPQERNQMTNFFNWFFFFISIGSLAAVTVLVYIQDNLGREWGYGICACAIVFGLVVFLSGTRRYRFKKLVGSPLTQIASVFVVAWRKRHLDLPSDPSMFFNIDDIPVEGKKTKQRLPHTKQFRFLDKAAIFKDSDMSNSTTVVINKWNLATLTDVEEVKMVIRMLPIWATTIIFWTVYAQMTTFSVSQATTMNRHIGSFEIPGASLTFFFVGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAARSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHKVTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKRLAEEGIELEEPEPACH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nitrate transporter 1.1 Dual affinity nitrate transporter. Involved in proton-dependent nitrate uptake and in the regulation of the nitrate transporter NRT2.1. Acts also as a nitrate sensor that trigger a specific signaling pathway stimulating lateral root growth and seed germination. The uptake activity is not required for sensor function. Displays an auxin transport facilitation inhibited by high nitrate concentration. Required to prevent auxin accumulation in preemerged lateral root primordia and young lateral roots when external nitrate concentration is low or null. May be involved in the basipetal transport of auxin out of the lateral root tips.probableQ05085

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XUT, chain A
Confidence level:very confident
Coverage over the Query: 33-119,144-246,267-402,418-443,454-548
View the alignment between query and template
View the model in PyMOL
Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 67-267,298-409,421-442,461-579
View the alignment between query and template
View the model in PyMOL