Citrus Sinensis ID: 007740

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-

MALVSSVPAIAQGVDSVRCPDIQMAGITSSRRGIVEEPVASVIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVRQQAPASCHIWFICNGNLIYTREGSLDGIDPEISSPSFQASHNTENRHPNCLRSQSVVLRHNRPMKLTNPVQDLFHRVRSMNFDRNVGNVMTSQDSIGGLSSPASRSDAEVSSDECTTGRSTSQGSLSSCSSRGVIDVAMIPLIRTEGVSTLPPSKEDLQSSPPSVLDGSVDDNLYDQLAQAMAEAENSRREAFEEALRRGKAEKDAIESIRRAKASESLYAEELKRRKEFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAVELLQNYKKEQDELQMERDKAVKEAEELRKSRKEASSSSHMPQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI

cccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHccccEEEEEEcccccHHHHHcccccHHHHHHHHccccccEEEEEEccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccccccccEEEEEcccEEEEEEccccccccHHHHHHHHHHHHHcccccccccccc

*****************************************VIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFP**********AYREIERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKK************RQQAPASCHIWFICNGNLIYTREG****************************************************************************************************************************************************************************************************************EALANGKLEL***************************************QKIISAVELL*************************************PQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MALVSSVPAIAQGVDSVRCPDIQMAGITSSRRGIVEEPVASVIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVRQQAPASCHIWFICNGNLIYTREGSLDGIDPEISSPSFQASHNTENRHPNCLRSQSVVLRHNRPMKLTNPVQDLFHRVRSMNFDRNVGNVMTSQDSIGGLSSPASRSDAEVSSDECTTGRSTSQGSLSSCSSRGVIDVAMIPLIRTEGVSTLPPSKEDLQSSPPSVLDGSVxxxxxxxxxxxxxxxxxxxxxxxxxALRRGKAEKDAIESIRRAKASESLYAEELKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHMPQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 123-151
View the alignment between query and template
View the model in PyMOL

Template: 2NRU, chain A
Confidence level:confident
Coverage over the Query: 514-590
View the alignment between query and template
View the model in PyMOL

Template: 1MJH, chain A
Confidence level:confident
Coverage over the Query: 44-83,99-200
View the alignment between query and template
View the model in PyMOL

Template: 2B9C, chain A
Confidence level:confident
Coverage over the Query: 393-478
View the alignment between query and template
View the model in PyMOL

Template: 2OCY, chain A
Confidence level:probable
Coverage over the Query: 357-431
View the alignment between query and template
View the model in PyMOL

Template: 3OJA, chain B
Confidence level:probable
Coverage over the Query: 459-498
View the alignment between query and template
View the model in PyMOL

Template: 1F5N, chain A
Confidence level:probable
Coverage over the Query: 337-502
View the alignment between query and template
View the model in PyMOL