Citrus Sinensis ID: 007740


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-
MALVSSVPAIAQGVDSVRCPDIQMAGITSSRRGIVEEPVASVIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVRQQAPASCHIWFICNGNLIYTREGSLDGIDPEISSPSFQASHNTENRHPNCLRSQSVVLRHNRPMKLTNPVQDLFHRVRSMNFDRNVGNVMTSQDSIGGLSSPASRSDAEVSSDECTTGRSTSQGSLSSCSSRGVIDVAMIPLIRTEGVSTLPPSKEDLQSSPPSVLDGSVDDNLYDQLAQAMAEAENSRREAFEEALRRGKAEKDAIESIRRAKASESLYAEELKRRKEFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAVELLQNYKKEQDELQMERDKAVKEAEELRKSRKEASSSSHMPQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI
cccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHccccEEEEEEcccccHHHHHcccccHHHHHHHHHcccccEEEEEEccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccccccccEEEEEcccEEEEEEccccccccHHHHHHHHHHHHHcccccccccccc
ccEEccccccccccccccccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHHccccEEEEEcccccccHHHccccccccHHHHHHccccccEEEEEEccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcHHHHHHHHHcccHHccccccccccEEEEEcccccEEEEEEcccHcccHHHHHHHHHHHHHccccccEEEEEc
malvssvpaiaqgvdsvrcpdiqmagitssrrgiveepvasvIEDKIYVAVAKQVKESKSVLLWALQnsggkriciihvhtpaqmipvmgtkfpassleeEKVQAYREIERQDMHNHLDMCLLICRQMGvraekldtesesTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVrqqapaschiWFICngnliytregsldgidpeisspsfqashntenrhpnclrsqsvvlrhnrpmkltnpvqDLFHRVRsmnfdrnvgnvmtsqdsigglsspasrsdaevssdecttgrstsqgslsscssrgvidvamiplirtegvstlppskedlqssppsvldgsvddNLYDQLAQAMAEAENSRREAFEEALRRGKAEKDAIESIRRAKASESLYAEELKRRKEFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAVELLQNYKKEQDELQMERDKAVKEAEELRKSrkeasssshmpqffsdfsfseiegathnfdpslkigeggygSIYKGLLRHMQVAIKMlhphslqgpsefqqevgAYESFIFHFNLVDSFI
malvssvpaiaqgvdsvrcpDIQMagitssrrgivEEPVASVIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLLICRQMGVRAEKldtesestEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVRQQAPASCHIWFICNGNLIYTREGSLDGIDPEISSPSFQAshntenrhpnCLRSqsvvlrhnrpmKLTNPVQDLFHRVRSMNFDRNVGNVMTSQDSIGGLSSPASRSDAEVSSdecttgrstsqgslsscssrGVIDVAMIPLIRTEGVstlppskedlqssppSVLDGSVDDNLYDQLAQAMAEAENSRREAFEEAlrrgkaekdaiesirrakaseslyaeELKRRKEFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAVELLQNYKKEQDELQMERDKAVKEAEELRKsrkeasssshmpqFFSDFSFSEIEGAThnfdpslkigEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI
MALVSSVPAIAQGVDSVRCPDIQMAGITSSRRGIVEEPVASVIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAAdkhykkkmmdlkskkAISVRQQAPASCHIWFICNGNLIYTREGSLDGIDPEISSPSFQASHNTENRHPNCLRSQSVVLRHNRPMKLTNPVQDLFHRVRSMNFDRNVGNVMTSQDSIGGLSSPASRSDAEVSSDECttgrstsqgslsscssrgVIDVAMIPLIRTEGVSTLPPSKEDLQSSPPSVLDGSVDDNLYDQLAQAMAEAENSRREAFEEALRRGKAEKDAIESIRRAKASESLYAEELKRRKEFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAVELLQNYKKEQDELQMERDKAVKEAEELRKSRKEASSSSHMPQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI
*********IAQGVDSVRCPDIQMAGITSSRRGIVEEPVASVIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFP**********AYREIERQDMHNHLDMCLLICRQMGVRA***********KGILELISHYGIRKLVMGAAADKHYKKK********AISVRQQAPASCHIWFICNGNLIYTREGS*********************************************VQDLFHRVRSM****************************************************GVIDVAMIPLIRT*******************************************************************************************************************************************************************************************DFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVD***
*********************************************KIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIP*********************IERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADK*****************RQQAPASCHIWFICNGNLIY********************************************************************************************************************************************************************************************************************EALANGKLEL***************************************QKIISAVELL*************************************PQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAI****************EVGAYESFIFHFNLVDSFI
MALVSSVPAIAQGVDSVRCPDIQMAGITSSRRGIVEEPVASVIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLLICRQMGVRAE*********EKGILELISHYGIRKLVMGAAADKHYKKKMM**************PASCHIWFICNGNLIYTREGSLDGIDPEISSPSFQASHNTENRHPNCLRSQSVVLRHNRPMKLTNPVQDLFHRVRSMNFDRNVGNVMTSQ*************************************SRGVIDVAMIPLIRTEGVST***************LDGSVDDNLYDQLAQ************************DAIESIRRAKASESLYAEELKRRKEFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAVELLQNYKKE******************************MPQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI
*****************************************VIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVRQQAPASCHIWFICNGNLIYTREG***************************************************************************************************************************************************DDNLYDQLAQAMAEAENSRREAFEEALRRGKAEKDAIESIRRAKASESLYAEELKRRKEFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAVELLQNYKKEQDELQMERDKAVKEAEELRKSRKEASSSSHMPQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALVSSVPAIAQGVDSVRCPDIQMAGITSSRRGIVEEPVASVIEDKIYVAVAKQVKESKSVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVRQQAPASCHIWFICNGNLIYTREGSLDGIDPEISSPSFQASHNTENRHPNCLRSQSVVLRHNRPMKLTNPVQDLFHRVRSMNFDRNVGNVMTSQDSIGGLSSPASRSDAEVSSDECTTGRSTSQGSLSSCSSRGVIDVAMIPLIRTEGVSTLPPSKEDLQSSPPSVLDGSVxxxxxxxxxxxxxxxxxxxxxxxxxALRRGKAEKDAIESIRRAKASESLYAEELKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHMPQFFSDFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLVDSFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query591 2.2.26 [Sep-21-2011]
Q8GUH1 834 U-box domain-containing p yes no 0.895 0.634 0.478 1e-134
Q8GZ84435 U-box domain-containing p no no 0.306 0.416 0.476 3e-42
Q683D5400 U-box domain-containing p no no 0.262 0.387 0.435 2e-34
Q94A51 805 U-box domain-containing p no no 0.314 0.231 0.382 5e-34
P0C6E7568 Putative U-box domain-con no no 0.568 0.591 0.314 1e-33
Q9LQ92308 U-box domain-containing p no no 0.296 0.568 0.416 1e-26
Q8GXQ7365 U-box domain-containing p no no 0.197 0.320 0.404 4e-16
C0LGG9 1035 Probable LRR receptor-lik no no 0.147 0.084 0.434 4e-10
C0LGG8 1038 Probable LRR receptor-lik no no 0.147 0.083 0.434 4e-10
C0LGH2 1032 Probable LRR receptor-lik no no 0.116 0.066 0.478 2e-09
>sp|Q8GUH1|PUB33_ARATH U-box domain-containing protein 33 OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2 Back     alignment and function desciption
 Score =  478 bits (1230), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 285/595 (47%), Positives = 385/595 (64%), Gaps = 66/595 (11%)

Query: 1   MALVSSVPAIAQGVDSVRCPDIQMAGITSSRRGIVEEPVASVIEDKIYVAVAKQVKESKS 60
           MALVS +PA+ +   S+R   I   G  SSR GI++EPV+ +I++KI+VAV K V +SKS
Sbjct: 1   MALVSPIPAMGERAGSMRFHGIGSPGSRSSRSGIMDEPVSRLIDEKIFVAVDKHVAKSKS 60

Query: 61  VLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDM 120
            L+WALQN+GGK+IC+IHVH P+QMIP+MG KFP  +++EE+V+ +RE ER+ +H  LD 
Sbjct: 61  TLIWALQNTGGKKICLIHVHQPSQMIPLMGAKFPVGAVKEEEVRVFREKEREKVHMILDD 120

Query: 121 CLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKA 180
            L IC+Q GVRAEK+  E ES E GI++LIS  GIRKLVMGAAAD+HY ++M DLKS+KA
Sbjct: 121 YLRICQQRGVRAEKMFIEMESIENGIVQLISELGIRKLVMGAAADRHYSRRMTDLKSRKA 180

Query: 181 ISVRQQAPASCHIWFICNGNLIYTREGSLDGIDPEISSPS--------FQASHNTENRHP 232
           I VR++AP  C IWF C G LI+TRE ++D  + E +SP          Q     E+ H 
Sbjct: 181 IFVRREAPTLCQIWFTCKGYLIHTREATMDDTESEYASPRPSISASDLLQTFSTPESEHQ 240

Query: 233 NCLRSQSVVLRHNRPMKLTNPVQDLFHRVRSMNFDRNVGNVMTSQDSIGGLSSPASRSDA 292
           +  R QS           T+ VQ L            V N  +++ S          SD 
Sbjct: 241 HISRVQS-----------TDSVQQL------------VSNGSSTEQS-------GRVSDG 270

Query: 293 EVSSDECTTGRSTSQGSLSSCSSRGVIDVAMIPLIRTEGVSTLPPSKEDLQSSPPSVLDG 352
            +++DE       S GS                     G +T+  S     SS P   DG
Sbjct: 271 SLNTDE---EERESDGS------------------EVTGSATVMSSGHSSPSSFP---DG 306

Query: 353 SVDDNLYDQLAQAMAEAENSRREAFEEALRRGKAEKDAIESIRRAKASESLYAEELKRRK 412
            VDD+   ++ +A +EA +S++EAF E LRR KAEK+A+++IRRAK SES Y+EELKRRK
Sbjct: 307 -VDDSFNVKIRKATSEAHSSKQEAFAETLRRQKAEKNALDAIRRAKQSESAYSEELKRRK 365

Query: 413 EFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAVE 472
           + E A+A  K     +K + + +MEELQ A+ QK++LESQIA+SD T ++L QK+  AV+
Sbjct: 366 DTEIAVAKEKERFITIKNEQEVIMEELQSAMAQKAMLESQIAKSDGTMEKLNQKLDIAVK 425

Query: 473 LLQNYKKEQDELQMERDKAVKEAEELRKSRKEASSSSHMPQFFSDFSFSEIEGATHNFDP 532
           LLQ  + E++ELQ ERD+A++EAEELR   +  +S+  +PQ+F+DFSFSEIE AT++FD 
Sbjct: 426 LLQKLRDEREELQTERDRALREAEELRSHAE--TSTLQLPQYFTDFSFSEIEEATNHFDS 483

Query: 533 SLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLV 587
           +LKIGEGGYGSIY GLLRH QVAIKML+P+S QGP E+QQEV    S + H N++
Sbjct: 484 TLKIGEGGYGSIYVGLLRHTQVAIKMLNPNSSQGPVEYQQEVDVL-SKMRHPNII 537




Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q8GZ84|PUB36_ARATH U-box domain-containing protein 36 OS=Arabidopsis thaliana GN=PUB36 PE=2 SV=2 Back     alignment and function description
>sp|Q683D5|PUB37_ARATH U-box domain-containing protein 37 OS=Arabidopsis thaliana GN=PUB37 PE=2 SV=1 Back     alignment and function description
>sp|Q94A51|PUB32_ARATH U-box domain-containing protein 32 OS=Arabidopsis thaliana GN=PUB32 PE=2 SV=1 Back     alignment and function description
>sp|P0C6E7|PUB55_ARATH Putative U-box domain-containing protein 55 OS=Arabidopsis thaliana GN=PUB55 PE=3 SV=1 Back     alignment and function description
>sp|Q9LQ92|PUB54_ARATH U-box domain-containing protein 54 OS=Arabidopsis thaliana GN=PUB54 PE=2 SV=1 Back     alignment and function description
>sp|Q8GXQ7|PUB56_ARATH U-box domain-containing protein 56 OS=Arabidopsis thaliana GN=PUB56 PE=2 SV=1 Back     alignment and function description
>sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2 Back     alignment and function description
>sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 Back     alignment and function description
>sp|C0LGH2|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query591
359489801 881 PREDICTED: U-box domain-containing prote 0.962 0.645 0.604 0.0
147772798 881 hypothetical protein VITISV_015820 [Viti 0.964 0.646 0.6 0.0
255541604529 receptor protein kinase, putative [Ricin 0.847 0.947 0.608 1e-178
224064033 809 predicted protein [Populus trichocarpa] 0.856 0.625 0.625 1e-175
87240964 884 Protein kinase; U box [Medicago truncatu 0.967 0.647 0.557 1e-162
357507363 896 U-box domain-containing protein [Medicag 0.967 0.638 0.557 1e-162
356568394 883 PREDICTED: U-box domain-containing prote 0.967 0.647 0.562 1e-161
224127680 810 predicted protein [Populus trichocarpa] 0.847 0.618 0.572 1e-159
356531997 883 PREDICTED: U-box domain-containing prote 0.967 0.647 0.558 1e-158
356522608 879 PREDICTED: U-box domain-containing prote 0.937 0.630 0.544 1e-158
>gi|359489801|ref|XP_002274993.2| PREDICTED: U-box domain-containing protein 33-like [Vitis vinifera] gi|297745303|emb|CBI40383.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/596 (60%), Positives = 450/596 (75%), Gaps = 27/596 (4%)

Query: 1   MALVSSVPAIAQGVDSVRCPDIQMAGITSSRRGIVEE-PVASVIEDKIYVAVAKQVKESK 59
           MA+VS VPAI+Q +D VR  +I ++ + SS   IVEE P+A V+EDKI+VAV K+VKESK
Sbjct: 1   MAVVSPVPAISQQLDHVRLHEIGVSAVMSSTGEIVEEQPLALVVEDKIFVAVGKEVKESK 60

Query: 60  SVLLWALQNSGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLD 119
           S+L+WALQNSGGKRI I+HVH PAQMIP+MG KFPAS L+E++V+AYR++ERQDMH  L+
Sbjct: 61  SILVWALQNSGGKRISIVHVHQPAQMIPIMGGKFPASKLKEQEVKAYRDLERQDMHKILN 120

Query: 120 MCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKK 179
             LLICR+ GVRAEKL  ESE+ EKGILELIS +GI+KLV+GAAADKHY ++M++ KSKK
Sbjct: 121 DYLLICRKAGVRAEKLYIESENVEKGILELISEHGIKKLVVGAAADKHYSRRMLEPKSKK 180

Query: 180 AISVRQQAPASCHIWFICNGNLIYTREGSLDGIDPEI-SSPSFQASHNTENRHPNCLRSQ 238
           A  VR +AP  CHIWF+C G+LIYTREGSL+G D E+ + PS QAS N E    N  RS 
Sbjct: 181 AAYVRDKAPLFCHIWFVCRGHLIYTREGSLNGADIELRTPPSQQASPNNETGQSNTFRSM 240

Query: 239 SVVLRHNRPMKLTNPVQDLFHRVRSMNFDRNVGNVMTSQDSIGGLSSPASRSDAEVSSD- 297
           SV L  N P KL NP QDL    R+M+    +  V++S D  GG+S+P SR   E SSD 
Sbjct: 241 SVSLGQNHPSKLVNPGQDL---PRTMSVPVRI-TVLSSPDGTGGVSAPWSRMGREGSSDY 296

Query: 298 -ECTTGRSTSQGS-LSSCSSRGVIDVAMIPLIRTEGVSTL--PPSKEDL-QSSPPSVLDG 352
            +  + RS SQ S  S+CSS       M   +  +G+ +   P +K+ L  SSPPSVL  
Sbjct: 297 WDGISKRSPSQASGFSTCSSGD-----MAGEVNEDGLESRASPVAKQALHHSSPPSVL-- 349

Query: 353 SVDDNLYDQLAQAMAEAENSRREAFEEALRRGKAEKDAIESIRRAKASESLYAEELKRRK 412
             ++N+YDQL QAM EAENSRREAF+E+LRR KAEKDAIE+IRRAK +E  ++EELK R+
Sbjct: 350 --EENIYDQLEQAMVEAENSRREAFQESLRRSKAEKDAIEAIRRAKEAERSFSEELKLRR 407

Query: 413 EFEEAL-ANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKELEQKIISAV 471
           + EEAL A GK ELE ++ +  E+MEEL+I+L+ KSLLE+QIA+S+Q  KELE+KII+AV
Sbjct: 408 DIEEALQAQGK-ELESLRNKQQEIMEELKISLNHKSLLENQIADSEQVVKELEEKIIAAV 466

Query: 472 ELLQNYKKEQDELQMERDKAVKEAEELRKSRKEASSSSHMPQFFSDFSFSEIEGATHNFD 531
           ELLQNYKKE+DELQ+ERD A+K AEEL   +K+ +S+SH PQ+F++FSF+EIE AT NFD
Sbjct: 467 ELLQNYKKERDELQIERDNAIKTAEEL---KKKGASTSHTPQYFAEFSFAEIEKATQNFD 523

Query: 532 PSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFHFNLV 587
           PS+KIGEGGYGSIYKG LRH QVAIKMLH  S QGP+EFQQEV    S + H NLV
Sbjct: 524 PSVKIGEGGYGSIYKGCLRHTQVAIKMLHSDSFQGPTEFQQEVDIL-SKLRHPNLV 578




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147772798|emb|CAN67166.1| hypothetical protein VITISV_015820 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255541604|ref|XP_002511866.1| receptor protein kinase, putative [Ricinus communis] gi|223549046|gb|EEF50535.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224064033|ref|XP_002301358.1| predicted protein [Populus trichocarpa] gi|222843084|gb|EEE80631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|87240964|gb|ABD32822.1| Protein kinase; U box [Medicago truncatula] Back     alignment and taxonomy information
>gi|357507363|ref|XP_003623970.1| U-box domain-containing protein [Medicago truncatula] gi|355498985|gb|AES80188.1| U-box domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356568394|ref|XP_003552396.1| PREDICTED: U-box domain-containing protein 33-like [Glycine max] Back     alignment and taxonomy information
>gi|224127680|ref|XP_002320134.1| predicted protein [Populus trichocarpa] gi|222860907|gb|EEE98449.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356531997|ref|XP_003534561.1| PREDICTED: U-box domain-containing protein 33-like [Glycine max] Back     alignment and taxonomy information
>gi|356522608|ref|XP_003529938.1| PREDICTED: U-box domain-containing protein 33-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query591
TAIR|locus:2050669 834 AT2G45910 [Arabidopsis thalian 0.406 0.287 0.573 1.5e-123
TAIR|locus:2101353 805 AT3G49060 [Arabidopsis thalian 0.375 0.275 0.375 3.3e-57
TAIR|locus:2098816435 AT3G61390 [Arabidopsis thalian 0.292 0.397 0.456 9.9e-49
TAIR|locus:2198165568 AT1G01660 [Arabidopsis thalian 0.296 0.308 0.355 4e-42
TAIR|locus:2082802294 AT3G61410 "AT3G61410" [Arabido 0.299 0.602 0.457 4.9e-37
TAIR|locus:2050659400 AT2G45920 [Arabidopsis thalian 0.192 0.285 0.426 7.4e-35
TAIR|locus:2198190308 PUB54 "plant U-box 54" [Arabid 0.296 0.568 0.389 1.2e-20
TAIR|locus:2198180365 AT1G01670 [Arabidopsis thalian 0.214 0.347 0.358 2.1e-18
TAIR|locus:2015656 758 AT1G16760 [Arabidopsis thalian 0.294 0.229 0.315 3.1e-17
TAIR|locus:2143094 701 AT5G12000 [Arabidopsis thalian 0.384 0.323 0.291 4.8e-17
TAIR|locus:2050669 AT2G45910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 649 (233.5 bits), Expect = 1.5e-123, Sum P(2) = 1.5e-123
 Identities = 140/244 (57%), Positives = 187/244 (76%)

Query:   344 SSPPSVLDGSVDDNLYDQLAQAMAEAENSRREAFEEALRRGKAEKDAIESIRRAKASESL 403
             SSP S  DG VDD+   ++ +A +EA +S++EAF E LRR KAEK+A+++IRRAK SES 
Sbjct:   298 SSPSSFPDG-VDDSFNVKIRKATSEAHSSKQEAFAETLRRQKAEKNALDAIRRAKQSESA 356

Query:   404 YAEELKRRKEFEEALANGKLELERMKKQHDEVMEELQIALDQKSLLESQIAESDQTAKEL 463
             Y+EELKRRK+ E A+A  K     +K + + +MEELQ A+ QK++LESQIA+SD T ++L
Sbjct:   357 YSEELKRRKDTEIAVAKEKERFITIKNEQEVIMEELQSAMAQKAMLESQIAKSDGTMEKL 416

Query:   464 EQKIISAVELLQNYKKEQDELQMERDKAVKEAEELRKSRKEASSSSHMPQFFSDFSFSEI 523
              QK+  AV+LLQ  + E++ELQ ERD+A++EAEELR S  E +S+  +PQ+F+DFSFSEI
Sbjct:   417 NQKLDIAVKLLQKLRDEREELQTERDRALREAEELR-SHAE-TSTLQLPQYFTDFSFSEI 474

Query:   524 EGATHNFDPSLKIGEGGYGSIYKGLLRHMQVAIKMLHPHSLQGPSEFQQEVGAYESFIFH 583
             E AT++FD +LKIGEGGYGSIY GLLRH QVAIKML+P+S QGP E+QQEV    S + H
Sbjct:   475 EEATNHFDSTLKIGEGGYGSIYVGLLRHTQVAIKMLNPNSSQGPVEYQQEVDVL-SKMRH 533

Query:   584 FNLV 587
              N++
Sbjct:   534 PNII 537


GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016567 "protein ubiquitination" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2101353 AT3G49060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098816 AT3G61390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198165 AT1G01660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082802 AT3G61410 "AT3G61410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050659 AT2G45920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198190 PUB54 "plant U-box 54" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198180 AT1G01670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015656 AT1G16760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143094 AT5G12000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00026876001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (849 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 5e-46
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 6e-05
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 7e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 9e-05
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 9e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-04
COG1340294 COG1340, COG1340, Uncharacterized archaeal coiled- 2e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 3e-04
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-04
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 8e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 9e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.001
pfam09731493 pfam09731, Mitofilin, Mitochondrial inner membrane 0.001
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
COG1842225 COG1842, PspA, Phage shock protein A (IM30), suppr 0.002
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 0.002
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
pfam04012220 pfam04012, PspA_IM30, PspA/IM30 family 0.003
pfam13514 1118 pfam13514, AAA_27, AAA domain 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam13949292 pfam13949, ALIX_LYPXL_bnd, ALIX V-shaped domain bi 0.004
PRK14139185 PRK14139, PRK14139, heat shock protein GrpE; Provi 0.004
COG4487 438 COG4487, COG4487, Uncharacterized protein conserve 0.004
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
 Score =  158 bits (402), Expect = 5e-46
 Identities = 54/156 (34%), Positives = 81/156 (51%), Gaps = 12/156 (7%)

Query: 46  KIYVAVAKQVKESKSVLLWALQN--SGGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKV 103
            + VAV K  K+SK+ L WAL N  + G+ I ++HVH P   IP    K        E  
Sbjct: 1   SVAVAVDK-DKKSKNALKWALDNLATKGQTIVLVHVHPPITSIPSSSGKL-------EVA 52

Query: 104 QAYREIERQDMHNHLDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAA 163
            AY++ E ++    L      C + GV+ E +  E +   K I+E ++ +GI KLVMGA+
Sbjct: 53  SAYKQEEDKEAKELLLPYRCFCSRKGVQCEDVVLEDDDVAKAIVEYVADHGITKLVMGAS 112

Query: 164 ADKHYKKKMMDLKSKKAISVRQQAPASCHIWFICNG 199
           +D H+  K    KS  A SV ++AP  C ++ +  G
Sbjct: 113 SDNHFSMK--FKKSDVASSVLKEAPDFCTVYVVSKG 146


The Serine Threonine kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. The N-terminal domain is homologous to the USP family which has a ATP binding fold. The N-terminal domain is predicted to be involved in ATP binding. Length = 146

>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217843 pfam04012, PspA_IM30, PspA/IM30 family Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|222469 pfam13949, ALIX_LYPXL_bnd, ALIX V-shaped domain binding to HIV Back     alignment and domain information
>gnl|CDD|237621 PRK14139, PRK14139, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 591
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.93
PRK15456142 universal stress protein UspG; Provisional 99.84
PRK15005144 universal stress protein F; Provisional 99.82
PRK09982142 universal stress protein UspD; Provisional 99.79
cd01987124 USP_OKCHK USP domain is located between the N-term 99.79
PRK15118144 universal stress global response regulator UspA; P 99.78
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.77
PRK10116142 universal stress protein UspC; Provisional 99.75
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.74
PRK11175305 universal stress protein UspE; Provisional 99.69
cd00293130 USP_Like Usp: Universal stress protein family. The 99.63
PRK11175305 universal stress protein UspE; Provisional 99.62
COG0589154 UspA Universal stress protein UspA and related nuc 99.58
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.37
PRK12652357 putative monovalent cation/H+ antiporter subunit E 99.32
PRK10490 895 sensor protein KdpD; Provisional 98.87
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 98.74
KOG0192 362 consensus Tyrosine kinase specific for activated ( 98.38
KOG0595 429 consensus Serine/threonine-protein kinase involved 98.3
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 98.15
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 98.11
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.08
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 98.03
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 98.0
PHA02988 283 hypothetical protein; Provisional 98.0
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 98.0
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 97.96
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 97.95
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 97.93
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 97.87
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 97.87
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 97.84
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 97.83
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 97.83
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 97.81
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 97.8
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 97.76
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 97.75
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 97.69
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 97.69
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 97.67
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 97.65
KOG0575 592 consensus Polo-like serine/threonine protein kinas 97.64
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 97.63
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 97.62
KOG2052 513 consensus Activin A type IB receptor, serine/threo 97.61
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 97.61
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 97.58
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 97.57
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 97.57
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 97.57
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 97.56
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 97.56
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 97.55
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 97.55
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 97.55
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 97.53
KOG3653 534 consensus Transforming growth factor beta/activin 97.53
PLN00034 353 mitogen-activated protein kinase kinase; Provision 97.53
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 97.52
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 97.52
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 97.51
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 97.5
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 97.5
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 97.49
PTZ00263 329 protein kinase A catalytic subunit; Provisional 97.49
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 97.49
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 97.47
PRK09188 365 serine/threonine protein kinase; Provisional 97.47
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 97.46
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 97.46
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 97.46
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 97.45
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 97.45
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 97.45
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 97.45
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 97.45
KOG0605 550 consensus NDR and related serine/threonine kinases 97.43
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 97.43
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 97.42
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 97.42
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 97.41
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 97.4
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 97.39
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 97.39
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 97.39
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 97.38
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 97.38
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 97.38
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 97.38
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 97.37
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 97.37
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 97.37
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 97.36
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 97.36
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 97.36
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 97.36
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 97.35
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 97.35
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 97.34
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 97.33
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 97.33
PTZ00036 440 glycogen synthase kinase; Provisional 97.33
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 97.33
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 97.32
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 97.32
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 97.32
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 97.32
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 97.32
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 97.32
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 97.32
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 97.31
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 97.31
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 97.31
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 97.31
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 97.3
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 97.3
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 97.3
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 97.3
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 97.3
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 97.29
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 97.29
KOG0586 596 consensus Serine/threonine protein kinase [General 97.28
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 97.28
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 97.27
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 97.27
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 97.27
PHA03212 391 serine/threonine kinase US3; Provisional 97.26
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 97.26
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 97.26
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 97.25
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 97.25
KOG0577 948 consensus Serine/threonine protein kinase [Signal 97.25
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 97.23
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 97.23
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 97.23
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 97.23
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 97.23
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 97.22
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 97.22
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 97.22
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 97.22
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 97.21
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 97.21
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 97.21
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 97.21
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 97.2
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 97.2
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 97.2
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 97.2
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 97.2
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 97.2
KOG0661 538 consensus MAPK related serine/threonine protein ki 97.19
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 97.19
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 97.19
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 97.19
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 97.19
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 97.19
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 97.18
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 97.18
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 97.18
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 97.18
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 97.17
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 97.17
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 97.17
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 97.17
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 97.17
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 97.16
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 97.16
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 97.16
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 97.16
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 97.16
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 97.16
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 97.16
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 97.15
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 97.15
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 97.15
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 97.14
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 97.14
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 97.14
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 97.14
KOG0198 313 consensus MEKK and related serine/threonine protei 97.13
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 97.13
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 97.13
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 97.13
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 97.13
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 97.13
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 97.12
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 97.12
PLN00009 294 cyclin-dependent kinase A; Provisional 97.12
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 97.12
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 97.12
KOG0201 467 consensus Serine/threonine protein kinase [Signal 97.12
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 97.12
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 97.12
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 97.12
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 97.12
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 97.11
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 97.11
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 97.11
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 97.1
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 97.1
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 97.09
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 97.09
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 97.09
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 97.09
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 97.08
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 97.08
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 97.08
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 97.08
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 97.08
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 97.07
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 97.07
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 97.06
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 97.06
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 97.06
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 97.06
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 97.05
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.05
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 97.04
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 97.04
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 97.04
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 97.04
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 97.04
KOG0598 357 consensus Ribosomal protein S6 kinase and related 97.03
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 97.03
PHA03211 461 serine/threonine kinase US3; Provisional 97.02
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 97.02
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 97.02
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 97.02
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 97.01
KOG0583 370 consensus Serine/threonine protein kinase [Signal 97.01
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 97.01
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 97.0
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 97.0
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 96.99
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 96.99
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 96.98
KOG0611 668 consensus Predicted serine/threonine protein kinas 96.98
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 96.98
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 96.98
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 96.97
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 96.97
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 96.96
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 96.96
PHA03209 357 serine/threonine kinase US3; Provisional 96.96
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 96.95
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 96.95
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 96.95
PLN03224 507 probable serine/threonine protein kinase; Provisio 96.95
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 96.94
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 96.94
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 96.93
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 96.93
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 96.92
KOG0581 364 consensus Mitogen-activated protein kinase kinase 96.92
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 96.92
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 96.92
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 96.92
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 96.91
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 96.91
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 96.9
KOG0582 516 consensus Ste20-like serine/threonine protein kina 96.9
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 96.89
PTZ00024 335 cyclin-dependent protein kinase; Provisional 96.88
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 96.88
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 96.88
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 96.88
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 96.86
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 96.86
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 96.86
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 96.85
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 96.84
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 96.84
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 96.83
PTZ00283 496 serine/threonine protein kinase; Provisional 96.82
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 96.82
KOG1989 738 consensus ARK protein kinase family [Signal transd 96.81
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 96.81
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 96.79
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 96.79
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 96.79
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 96.78
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 96.78
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 96.78
PTZ00266 1021 NIMA-related protein kinase; Provisional 96.75
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 96.74
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 96.74
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 96.72
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 96.7
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 96.69
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 96.69
PHA03207 392 serine/threonine kinase US3; Provisional 96.68
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 96.66
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 96.63
KOG4721 904 consensus Serine/threonine protein kinase, contain 96.63
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 96.63
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 96.6
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 96.6
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 96.58
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 96.56
PTZ00267 478 NIMA-related protein kinase; Provisional 96.53
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 96.53
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 96.51
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 96.49
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 96.49
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 96.49
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 96.46
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.45
PRK10345 210 hypothetical protein; Provisional 96.43
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 96.39
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 96.39
PTZ00284 467 protein kinase; Provisional 96.37
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.37
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 96.36
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 96.34
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 96.3
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 96.3
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 96.27
PHA03210 501 serine/threonine kinase US3; Provisional 96.25
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 96.24
KOG4717 864 consensus Serine/threonine protein kinase [Signal 96.24
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 96.21
PRK11637 428 AmiB activator; Provisional 96.17
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 96.14
KOG0578 550 consensus p21-activated serine/threonine protein k 96.08
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 96.07
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 95.94
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 95.92
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 95.88
cd05147 190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 95.83
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 95.82
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 95.79
PRK09039343 hypothetical protein; Validated 95.68
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 95.65
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 95.63
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 95.63
PLN03159832 cation/H(+) antiporter 15; Provisional 95.51
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 95.48
PRK09039343 hypothetical protein; Validated 95.48
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 95.4
KOG0607 463 consensus MAP kinase-interacting kinase and relate 95.36
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 95.35
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 95.3
PRK00106 535 hypothetical protein; Provisional 95.29
PRK12704 520 phosphodiesterase; Provisional 95.26
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.26
KOG0694 694 consensus Serine/threonine protein kinase [Signal 95.19
COG4372499 Uncharacterized protein conserved in bacteria with 95.16
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 95.15
KOG0584 632 consensus Serine/threonine protein kinase [General 95.1
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.04
PRK10359 232 lipopolysaccharide core biosynthesis protein; Prov 95.0
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 95.0
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 94.93
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 94.91
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 94.9
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 94.87
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 94.87
KOG1152 772 consensus Signal transduction serine/threonine kin 94.86
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 94.85
KOG0589 426 consensus Serine/threonine protein kinase [General 94.85
PRK09605 535 bifunctional UGMP family protein/serine/threonine 94.8
cd05145 190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 94.66
PHA02882 294 putative serine/threonine kinase; Provisional 94.63
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 94.55
PRK12704 520 phosphodiesterase; Provisional 94.38
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 94.38
PRK04863 1486 mukB cell division protein MukB; Provisional 94.37
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.28
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 94.26
COG4026290 Uncharacterized protein containing TOPRIM domain, 94.22
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 94.17
KOG0576 829 consensus Mitogen-activated protein kinase kinase 94.15
KOG2891445 consensus Surface glycoprotein [General function p 94.05
PRK00106 535 hypothetical protein; Provisional 94.0
PRK02224 880 chromosome segregation protein; Provisional 93.96
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 93.92
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 93.73
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 93.72
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 93.62
COG4372 499 Uncharacterized protein conserved in bacteria with 93.38
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 93.38
KOG0610 459 consensus Putative serine/threonine protein kinase 93.31
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 93.24
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 93.19
COG11961163 Smc Chromosome segregation ATPases [Cell division 93.18
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 93.11
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 93.08
KOG1027 903 consensus Serine/threonine protein kinase and endo 93.04
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 93.01
KOG0933 1174 consensus Structural maintenance of chromosome pro 92.94
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 92.9
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 92.79
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 92.59
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 92.55
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 92.49
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 92.36
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 92.28
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.28
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 92.22
cd05119 187 RIO RIO kinase family, catalytic domain. The RIO k 92.22
COG4942 420 Membrane-bound metallopeptidase [Cell division and 92.17
COG4942 420 Membrane-bound metallopeptidase [Cell division and 92.09
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 92.02
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 91.93
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 91.65
PRK04863 1486 mukB cell division protein MukB; Provisional 91.59
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 91.59
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 91.4
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 91.37
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 91.25
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 91.19
KOG0690 516 consensus Serine/threonine protein kinase [Signal 91.08
PRK02224 880 chromosome segregation protein; Provisional 91.04
PRK03918 880 chromosome segregation protein; Provisional 91.03
KOG0996 1293 consensus Structural maintenance of chromosome pro 90.94
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 90.89
PRK12342254 hypothetical protein; Provisional 90.84
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 90.73
KOG1003205 consensus Actin filament-coating protein tropomyos 90.43
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 90.32
KOG0996 1293 consensus Structural maintenance of chromosome pro 90.27
smart00090 237 RIO RIO-like kinase. 90.16
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 90.13
KOG0964 1200 consensus Structural maintenance of chromosome pro 90.08
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 90.01
PRK10884206 SH3 domain-containing protein; Provisional 89.87
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 89.79
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 89.63
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 89.61
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 89.55
KOG0933 1174 consensus Structural maintenance of chromosome pro 89.4
KOG0964 1200 consensus Structural maintenance of chromosome pro 89.29
KOG4364 811 consensus Chromatin assembly factor-I [Chromatin s 89.13
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 89.0
PF05262489 Borrelia_P83: Borrelia P83/100 protein; InterPro: 88.99
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 88.9
PRK13820394 argininosuccinate synthase; Provisional 88.89
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 88.85
PF04949159 Transcrip_act: Transcriptional activator; InterPro 88.43
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 88.34
PRK03359256 putative electron transfer flavoprotein FixA; Revi 88.14
PRK04778569 septation ring formation regulator EzrA; Provision 88.1
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 88.08
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 87.84
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 87.38
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 87.34
PF05262489 Borrelia_P83: Borrelia P83/100 protein; InterPro: 87.24
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 86.85
COG0515 384 SPS1 Serine/threonine protein kinase [General func 86.74
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 86.71
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 86.56
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 86.35
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 86.19
KOG2891445 consensus Surface glycoprotein [General function p 86.17
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 85.85
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 85.85
COG2433652 Uncharacterized conserved protein [Function unknow 85.74
PRK10884206 SH3 domain-containing protein; Provisional 85.71
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 85.62
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 85.53
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 85.38
PHA02562562 46 endonuclease subunit; Provisional 85.38
PRK00409782 recombination and DNA strand exchange inhibitor pr 85.32
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 85.23
KOG2751447 consensus Beclin-like protein [Signal transduction 84.87
PRK12274 218 serine/threonine protein kinase; Provisional 84.73
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 84.62
COG2433652 Uncharacterized conserved protein [Function unknow 84.34
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 84.27
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 84.25
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 84.14
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 84.13
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 84.11
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 84.11
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 84.05
COG5185 622 HEC1 Protein involved in chromosome segregation, i 83.66
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 83.46
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 83.24
KOG0979 1072 consensus Structural maintenance of chromosome pro 83.04
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 83.01
PF12072201 DUF3552: Domain of unknown function (DUF3552); Int 82.98
KOG0596 677 consensus Dual specificity; serine/threonine and t 82.95
KOG0971 1243 consensus Microtubule-associated protein dynactin 82.9
PF12072201 DUF3552: Domain of unknown function (DUF3552); Int 82.65
KOG1167 418 consensus Serine/threonine protein kinase of the C 82.53
KOG2751 447 consensus Beclin-like protein [Signal transduction 82.22
PTZ00121 2084 MAEBL; Provisional 82.15
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 82.07
PRK12705 508 hypothetical protein; Provisional 81.89
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 81.77
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine n 81.59
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 81.55
KOG4807593 consensus F-actin binding protein, regulates actin 81.31
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 81.3
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 81.19
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 81.14
PRK10660436 tilS tRNA(Ile)-lysidine synthetase; Provisional 81.04
PTZ00121 2084 MAEBL; Provisional 81.03
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
Probab=99.93  E-value=1.7e-25  Score=207.23  Aligned_cols=143  Identities=36%  Similarity=0.580  Sum_probs=123.1

Q ss_pred             EEEEeecCChHHHHHHHHHHHHhc--CCCeEEEEEEeCCCCcccccCCCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHH
Q 007740           46 KIYVAVAKQVKESKSVLLWALQNS--GGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMCLL  123 (591)
Q Consensus        46 kIlVAVD~S~~~S~~Al~wAl~~~--~g~~I~llHV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lL~~~~~  123 (591)
                      +||||||+| +.|.+||+||++++  .+++|++|||.++..+.+...+  .     ......+.+..++.++++|+++..
T Consensus         1 ~ILVavD~S-~~s~~al~~a~~~a~~~~~~l~ll~v~~~~~~~~~~~~--~-----~~~~~~~~~~~~~~~~~~l~~~~~   72 (146)
T cd01989           1 SVAVAVDKD-KKSKNALKWALDNLATKGQTIVLVHVHPPITSIPSSSG--K-----LEVASAYKQEEDKEAKELLLPYRC   72 (146)
T ss_pred             CEEEEecCc-cccHHHHHHHHHhccCCCCcEEEEEeccCcccCCCCcc--c-----hHHHHHHHHHHHHHHHHHHHHHHH
Confidence            599999999 99999999999988  5889999999987543221111  0     022344556677888999999999


Q ss_pred             HHHHcCCceEEEEEecCChHHHHHHHHHHcCCCEEEEccCCCchhhHHhcc-CCcchHHHHhccCCCccEEEEEcCC
Q 007740          124 ICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMD-LKSKKAISVRQQAPASCHIWFICNG  199 (591)
Q Consensus       124 ~c~~~gV~~e~~vie~~~~~~~Ive~a~~~~idlIVmGs~g~~~~~R~l~G-s~s~Va~~V~~~Ap~~C~V~vV~kg  199 (591)
                      .|...|+.++..++.+++|++.|+++|+++++|+||||+||++++.|+|+| |   |+.+|++++|++|+|+||++|
T Consensus        73 ~~~~~~~~~~~~~~~g~~~~~~I~~~a~~~~~dlIV~Gs~g~~~l~~~~~gss---va~~Vi~~a~~~c~Vlvv~~~  146 (146)
T cd01989          73 FCSRKGVQCEDVVLEDDDVAKAIVEYVADHGITKLVMGASSDNHFSMKFKKSD---VASSVLKEAPDFCTVYVVSKG  146 (146)
T ss_pred             HHhhcCCeEEEEEEeCCcHHHHHHHHHHHcCCCEEEEeccCCCceeecccCCc---hhHHHHhcCCCCceEEEEeCc
Confidence            999899999999999889999999999999999999999999999999987 5   999999999999999999997



The Serine Threonine kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. The N-terminal domain is homologous to the USP family which has a ATP binding fold. The N-terminal domain is predicted to be involved in ATP binding.

>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information
>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 2e-05
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 2e-05
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 3e-05
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 5e-05
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 1e-04
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 1e-04
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure

Iteration: 1

Score = 47.4 bits (111), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 6/51 (11%) Query: 515 FSDFSFSEIEGATHNFD------PSLKIGEGGYGSIYKGLLRHMQVAIKML 559 F FSF E++ T+NFD K+GEGG+G +YKG + + VA+K L Sbjct: 12 FHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKL 62
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 4e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 7e-17
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-16
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 2e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 7e-06
3soc_A 322 Activin receptor type-2A; structural genomics cons 4e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-05
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 1e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 6e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 7e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 7e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-06
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-06
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 5e-06
2zuo_A861 MVP, major vault protein; repeat domains, protein- 8e-06
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-05
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-05
3q4u_A 301 Activin receptor type-1; structural genomics conso 2e-05
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-05
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 2e-05
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 3e-05
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-05
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-05
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 4e-05
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 5e-05
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 7e-05
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 1e-04
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 2e-04
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 2e-04
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 3e-04
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 3e-04
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 3e-04
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 3e-04
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 3e-04
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 4e-04
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 4e-04
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 4e-04
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 5e-04
4aoj_A 329 High affinity nerve growth factor receptor; transf 5e-04
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 6e-04
3haj_A 486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 6e-04
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 7e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 8e-04
2xs1_A704 Programmed cell death 6-interacting protein; prote 8e-04
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 9e-04
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 9e-04
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
 Score = 96.5 bits (241), Expect = 4e-22
 Identities = 37/89 (41%), Positives = 51/89 (57%), Gaps = 3/89 (3%)

Query: 501 SRKEASSSSHMPQFFS-DFSFSEIEGATHNFDPSLKIGEGGYGSIYKGLLRH-MQVAIKM 558
           S  +A SSS++  F S      ++E AT+NFD    IG G +G +YKG+LR   +VA+K 
Sbjct: 11  SINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKR 70

Query: 559 LHPHSLQGPSEFQQEVGAYESFIFHFNLV 587
             P S QG  EF+ E+    SF  H +LV
Sbjct: 71  RTPESSQGIEEFETEIETL-SFCRHPHLV 98


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query591
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.86
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.86
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.85
3fg9_A156 Protein of universal stress protein USPA family; A 99.84
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.84
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.83
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.82
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.82
2z08_A137 Universal stress protein family; uncharacterized c 99.81
3dlo_A155 Universal stress protein; unknown function, struct 99.81
3tnj_A150 Universal stress protein (USP); structural genomic 99.8
3fdx_A143 Putative filament protein / universal stress PROT; 99.79
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.75
3olq_A319 Universal stress protein E; structural genomics, P 99.7
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.7
3loq_A294 Universal stress protein; structural genomics, PSI 99.69
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.69
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.68
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.67
3olq_A319 Universal stress protein E; structural genomics, P 99.65
3loq_A294 Universal stress protein; structural genomics, PSI 99.64
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.63
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.63
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.46
4aoj_A 329 High affinity nerve growth factor receptor; transf 98.78
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 98.76
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 98.69
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 98.6
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 98.56
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.49
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 98.48
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 98.46
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 98.45
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 98.43
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 98.42
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 98.42
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 98.4
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 98.37
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 98.36
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 98.33
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 98.26
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 98.21
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 98.2
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 98.05
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.04
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 98.02
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.01
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 98.0
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 98.0
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 97.96
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 97.96
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 97.96
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 97.95
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 97.94
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 97.92
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 97.91
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 97.91
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 97.89
3uqc_A 286 Probable conserved transmembrane protein; structur 97.88
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 97.87
3soc_A 322 Activin receptor type-2A; structural genomics cons 97.87
3o0g_A 292 Cell division protein kinase 5; kinase activator c 97.86
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 97.85
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 97.85
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 97.85
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 97.85
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 97.84
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 97.84
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 97.83
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 97.83
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 97.83
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 97.82
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 97.81
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 97.81
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 97.8
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 97.79
3niz_A 311 Rhodanese family protein; structural genomics, str 97.79
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 97.79
3rp9_A 458 Mitogen-activated protein kinase; structural genom 97.78
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.78
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 97.78
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 97.78
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 97.78
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 97.77
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 97.77
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 97.75
3ork_A 311 Serine/threonine protein kinase; structural genomi 97.75
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 97.74
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 97.74
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 97.74
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 97.74
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 97.74
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 97.74
3q4u_A 301 Activin receptor type-1; structural genomics conso 97.74
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 97.74
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 97.74
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 97.74
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 97.73
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 97.73
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 97.73
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 97.71
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 97.7
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 97.7
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 97.7
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 97.7
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 97.7
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 97.69
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 97.69
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 97.68
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 97.68
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 97.68
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 97.68
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 97.68
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 97.68
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 97.67
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 97.67
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 97.67
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 97.67
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 97.67
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 97.67
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 97.66
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 97.66
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 97.66
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 97.66
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 97.66
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 97.65
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 97.65
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 97.65
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 97.65
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 97.65
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 97.65
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 97.65
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 97.65
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 97.64
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 97.64
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 97.64
3bhy_A 283 Death-associated protein kinase 3; death associate 97.64
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 97.63
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 97.63
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 97.63
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 97.63
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 97.63
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 97.63
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 97.62
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 97.62
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 97.62
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 97.62
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 97.62
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 97.61
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 97.61
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 97.61
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 97.6
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 97.6
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 97.59
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 97.59
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 97.58
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 97.58
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 97.58
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 97.58
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 97.58
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 97.57
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 97.57
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 97.57
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 97.57
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 97.57
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 97.56
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 97.56
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 97.56
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 97.56
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 97.56
3pls_A 298 Macrophage-stimulating protein receptor; protein k 97.55
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 97.55
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 97.54
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 97.54
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 97.54
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 97.53
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 97.53
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 97.53
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 97.53
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 97.52
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 97.52
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 97.52
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 97.52
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 97.52
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 97.52
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 97.52
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 97.51
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 97.51
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 97.51
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 97.51
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 97.51
2a19_B 284 Interferon-induced, double-stranded RNA-activated 97.5
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 97.5
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 97.5
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 97.49
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 97.49
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 97.49
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 97.49
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 97.48
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 97.48
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 97.48
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 97.47
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 97.47
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 97.47
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 97.46
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 97.46
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 97.45
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 97.45
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 97.44
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 97.44
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 97.44
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 97.44
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 97.43
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 97.43
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 97.41
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 97.4
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 97.4
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 97.4
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 97.39
3aln_A 327 Dual specificity mitogen-activated protein kinase; 97.38
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 97.38
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 97.37
3an0_A 340 Dual specificity mitogen-activated protein kinase; 97.37
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 97.37
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 97.36
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 97.35
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 97.35
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 97.34
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 97.34
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 97.34
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 97.33
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 97.32
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 97.32
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 97.31
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 97.31
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 97.31
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 97.3
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 97.3
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 97.27
3fme_A 290 Dual specificity mitogen-activated protein kinase; 97.26
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 97.2
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 97.19
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 97.18
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 97.16
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 97.15
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 97.13
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 97.1
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 97.09
2dyl_A 318 Dual specificity mitogen-activated protein kinase 97.08
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 97.08
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 97.07
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 97.06
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 97.04
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 97.03
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 97.0
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 96.99
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 96.99
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 96.98
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 96.98
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 96.96
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 96.95
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 96.95
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 96.82
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 96.79
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 96.76
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 96.74
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 96.72
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 96.71
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 96.7
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 96.68
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 96.58
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 96.46
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 96.38
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.23
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 96.14
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 95.96
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.96
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 95.89
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 95.48
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.91
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 94.91
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 94.69
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.65
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 94.22
3qwe_A279 GMIP, GEM-interacting protein; structural genomics 94.03
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 93.76
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 93.62
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 93.18
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 92.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.43
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 92.28
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 92.26
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 92.23
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 91.62
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 91.58
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 90.08
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 89.44
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 89.43
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 89.0
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 87.73
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 87.25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 86.64
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 86.38
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 85.14
1k92_A455 Argininosuccinate synthase, argininosuccinate SY; 84.93
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 84.4
1ni5_A433 Putative cell cycle protein MESJ; structural genom 84.15
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 83.68
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 83.33
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 83.32
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 83.11
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 82.6
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 81.96
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 81.84
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 81.44
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 81.4
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 81.24
3bas_A89 Myosin heavy chain, striated muscle/general contro 80.77
2nz2_A413 Argininosuccinate synthase; amino-acid biosynthesi 80.74
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 80.29
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 80.02
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.86  E-value=3.1e-21  Score=176.18  Aligned_cols=138  Identities=12%  Similarity=0.119  Sum_probs=118.4

Q ss_pred             CCEEEEeecCChHHHHHHHHHHHHhc--CCCeEEEEEEeCCCCcccccCCCCCCCcchHHHHHHHHHHHHHHHHHHHHHH
Q 007740           44 EDKIYVAVAKQVKESKSVLLWALQNS--GGKRICIIHVHTPAQMIPVMGTKFPASSLEEEKVQAYREIERQDMHNHLDMC  121 (591)
Q Consensus        44 ~~kIlVAVD~S~~~S~~Al~wAl~~~--~g~~I~llHV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lL~~~  121 (591)
                      -++||||||+| +.|..||+||+.++  .+++|++|||.++........        . .....+.+..++.+++.|+.+
T Consensus         5 ~~~ILv~~D~s-~~s~~al~~A~~la~~~~a~l~ll~v~~~~~~~~~~~--------~-~~~~~~~~~~~~~~~~~l~~~   74 (146)
T 3s3t_A            5 YTNILVPVDSS-DAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHTPAL--------D-PVLSELLDAEAAHAKDAMRQR   74 (146)
T ss_dssp             CCEEEEECCSS-HHHHHHHHHHHHHHHHHTCEEEEEEEEECCCCCCGGG--------H-HHHHHHHHHHHHHHHHHHHHH
T ss_pred             cceEEEEcCCC-HHHHHHHHHHHHHHHhcCCEEEEEEEecCcccccccc--------c-cccHHHHHHHHHHHHHHHHHH
Confidence            37999999999 99999999999988  589999999998764321100        0 123445666778889999999


Q ss_pred             HHHHHHcCC-ceEEEEEecCChHHHHHH-HHHHcCCCEEEEccCCCchhhHHhccCCcchHHHHhccCCCccEEEEEc
Q 007740          122 LLICRQMGV-RAEKLDTESESTEKGILE-LISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVRQQAPASCHIWFIC  197 (591)
Q Consensus       122 ~~~c~~~gV-~~e~~vie~~~~~~~Ive-~a~~~~idlIVmGs~g~~~~~R~l~Gs~s~Va~~V~~~Ap~~C~V~vV~  197 (591)
                      ...+...|+ +++..+..| ++++.|++ +|++.++|+||||++|++++.+.++||   ++.+|+++++  |+||||.
T Consensus        75 ~~~~~~~g~~~~~~~~~~g-~~~~~I~~~~a~~~~~dliV~G~~~~~~~~~~~~Gs---~~~~vl~~~~--~pVlvV~  146 (146)
T 3s3t_A           75 QQFVATTSAPNLKTEISYG-IPKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGS---TTSYVVDHAP--CNVIVIR  146 (146)
T ss_dssp             HHHHTTSSCCCCEEEEEEE-CHHHHHHHHHHHSTTCCEEEEESCCSSCTTTCSSCH---HHHHHHHHCS--SEEEEEC
T ss_pred             HHHHHhcCCcceEEEEecC-ChHHHHHHHHHhhcCCCEEEECCCCCCCcceEEEcc---hHHHHhccCC--CCEEEeC
Confidence            999999999 988887776 78999999 999999999999999999999999998   9999999999  9999983



>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 591
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-08
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 6e-07
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-06
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 4e-06
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 5e-06
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-06
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 7e-06
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-05
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-05
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-05
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-05
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-05
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-05
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-05
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-05
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 3e-05
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-05
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-05
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 7e-05
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 7e-05
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 7e-05
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-04
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-04
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-04
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-04
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-04
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-04
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 2e-04
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-04
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-04
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-04
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 4e-04
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 4e-04
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 4e-04
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 5e-04
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-04
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-04
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 7e-04
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 0.001
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 0.001
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 0.001
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 0.001
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 0.001
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 0.002
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 0.002
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 0.003
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 0.003
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 0.004
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 53.2 bits (127), Expect = 3e-08
 Identities = 20/89 (22%), Positives = 33/89 (37%), Gaps = 16/89 (17%)

Query: 514 FFSDFSFSEIEGATHNFDPSL---------KIGEGGYGSIYKGLLR-----HMQVAIKML 559
           F   F+F +   A   F   +          IG G +G +  G L+      + VAIK L
Sbjct: 3   FIDPFTFEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTL 62

Query: 560 HP-HSLQGPSEFQQEVGAYESFIFHFNLV 587
              ++ +   +F  E         H N++
Sbjct: 63  KSGYTEKQRRDFLSEASIMGQ-FDHPNVI 90


>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query591
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.9
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.9
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.86
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.83
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.77
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.76
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 98.76
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 98.73
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 98.63
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.62
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 98.61
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 98.61
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 98.58
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 98.57
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 98.5
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 98.5
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 98.49
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 98.48
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 98.47
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 98.46
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 98.43
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 98.43
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 98.4
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 98.4
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 98.39
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 98.39
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 98.38
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 98.38
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 98.35
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 98.34
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 98.33
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 98.31
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 98.3
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 98.28
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 98.28
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 98.26
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 98.25
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 98.23
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 98.22
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 98.22
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 98.22
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 98.22
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 98.17
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 98.16
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 98.15
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 98.14
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 98.13
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 98.12
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 98.11
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 98.1
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 98.09
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 98.07
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 98.05
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 98.04
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 98.01
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 97.95
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 97.89
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 97.88
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 97.87
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 97.87
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 97.68
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 97.68
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 97.66
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 97.62
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 97.45
d1zara2 191 Rio2 serine protein kinase C-terminal domain {Arch 97.09
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 97.04
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 94.14
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 87.74
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 86.26
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 82.72
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=99.90  E-value=2.3e-23  Score=192.06  Aligned_cols=148  Identities=10%  Similarity=0.129  Sum_probs=121.6

Q ss_pred             CEEEEeecCChHHHHHHHHHHHHhc--CCCeEEEEEEeCCCCcccc-----cCCCCCCCcchHHHHHHHHHHHHHHHHHH
Q 007740           45 DKIYVAVAKQVKESKSVLLWALQNS--GGKRICIIHVHTPAQMIPV-----MGTKFPASSLEEEKVQAYREIERQDMHNH  117 (591)
Q Consensus        45 ~kIlVAVD~S~~~S~~Al~wAl~~~--~g~~I~llHV~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  117 (591)
                      ++||||||+| +.|.+||+||++++  .+++|+|+||.++......     ..+........+.....+.+...+++++.
T Consensus         4 ~~ILvavD~s-~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (160)
T d1mjha_           4 KKILYPTDFS-ETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAKNK   82 (160)
T ss_dssp             CEEEEECCSC-HHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHHHH
T ss_pred             CeEEEEECCC-HHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHHHHH
Confidence            6999999999 99999999999998  6889999999877543211     01111111222334455667778889999


Q ss_pred             HHHHHHHHHHcCCceEEEEEecCChHHHHHHHHHHcCCCEEEEccCCCchhhHHhccCCcchHHHHhccCCCccEEEEEc
Q 007740          118 LDMCLLICRQMGVRAEKLDTESESTEKGILELISHYGIRKLVMGAAADKHYKKKMMDLKSKKAISVRQQAPASCHIWFIC  197 (591)
Q Consensus       118 L~~~~~~c~~~gV~~e~~vie~~~~~~~Ive~a~~~~idlIVmGs~g~~~~~R~l~Gs~s~Va~~V~~~Ap~~C~V~vV~  197 (591)
                      |+.+...|...||+++..+..| +|+..|+++|+++++|+||||+||++++.++|+||   ++.+|+++++  |+||||.
T Consensus        83 l~~~~~~~~~~gv~~~~~~~~G-~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS---~a~~vl~~s~--~pVlvV~  156 (160)
T d1mjha_          83 MENIKKELEDVGFKVKDIIVVG-IPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGS---VTENVIKKSN--KPVLVVK  156 (160)
T ss_dssp             HHHHHHHHHHTTCEEEEEEEEE-CHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCH---HHHHHHHHCC--SCEEEEC
T ss_pred             HHHHHHHHHhcCCeEEEEEEec-cHHHHHhhhhhccccceEEeccCCCCcccccccCc---HHHHHHhcCC--CCEEEEc
Confidence            9999999999999999888876 89999999999999999999999999999999998   9999999999  9999997


Q ss_pred             CC
Q 007740          198 NG  199 (591)
Q Consensus       198 kg  199 (591)
                      +.
T Consensus       157 ~~  158 (160)
T d1mjha_         157 RK  158 (160)
T ss_dssp             CC
T ss_pred             CC
Confidence            64



>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure