Citrus Sinensis ID: 007826


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59
MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISTNDPYSMNFKFILADTVQKIIVLLLLAIWSKLSSSGSLEWSITLFSLSTLPNTLVMGIPLLKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGSIISFKVDSDIISLDGKEPLQTEAEVGEDGKLHVTVRKSASSRSEIFSRRSHGPNSGVSLTPRPSNLTNCEIYSLQSSRNHTPRGSSFNHTDVFSMVNGKNMSNVSPRQSNFGNLGFDEENGVGVFGNVNRANGGPYPVPTTAGIFSPVSGAMRKANGAENGKDLHMFVWSSSASPVSEGGLHVFRGGDDLGGVHQKDYGEFGRDEFSFGNRPVTNGVENEGPVLSKLGSSSTTELNPKSVAQGEPKPTAMPPTSVMTRLILIMVWRKLIRNPNTYSSLIGLTWSLVSFRWHVEMPAIIARSIAILSDAGLGMAMFSLGLFMALQPRIIACGNTIATFAMGVRFLVGPAVMAAASMAVGLRGSLLHVAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITLVYYILLGL
cccccHHHHHHHHHHHHHHHHHHHHHHEEEEEcccHHHHHHHHHHHHHHHHccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEccccccHHccccccccccccccccccccccccEEEEECccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
**SATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISTNDPYSMNFKFILADTVQKIIVLLLLAIWSKLSSSGSLEWSITLFSLSTLPNTLVMGIPLLKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGSIISFKVDSDIISL**************************************************SNLTNCEIYSL****************************************************************************************DLHMFVWS************************************************************************************VMTRLILIMVWRKLIRNPNTYSSLIGLTWSLVSFRWHVEMPAIIARSIAILSDAGLGMAMFSLGLFMALQPRIIACGNTIATFAMGVRFLVGPAVMAAASMAVGLRGSLLHVAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITLVYYILLGL
xxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISTNDPYSMNFKFILADTVQKIIVLLLLAIWSKLSSSGSLEWSITLFSLSTLPNTLVMGIPLLKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGSIISFKVDSDIISLDGKEPLQTEAEVGEDGKLHVTVRKSASSRSEIFSRRSHGPNSGVSLTPRPSNLTNCEIYSLQSSRNHTPRGSSFNHTDVFSMVNGKNMSNVSPRQSNFGNLGFDEENGVGVFGNVNRANGGPYPVPTTAGIFSPVSGAMRKANGAENGKDLHMFVWSSSASPVSEGGLHVFRGGDDLGGVHQKDYGEFGRDEFSFGNRPVTNGVENEGPVLSKLGSSSTTELNPKSVAQGEPKPTAMPPTSVMTRLILIMVWRKLIRNPNTYSSLIGLTWSLVSFRWHVEMPAIIARSIAILSDAGLGMAMFSLGLFMALQPRIIACGNTIATFAMGVRFLVGPAVMAAASMAVGLRGSLLHVAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITLVYYILLGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable auxin efflux carrier component 1c May act as a component of the auxin efflux carrier.probableQ67UL3
Auxin efflux carrier component 1 Acts as a component of the auxin efflux carrier. Seems to be involved in the basipetal auxin transport. Mediates the formation of auxin gradient which is required to ensure correct organogenesis. Coordinated polar localization of PIN1 is directly regulated by the vesicle trafficking process and apical-basal PIN1 polarity also depends on the phosphorylation of conserved serine residues by PID kinase. The ARF-GEF protein GNOM is required for the correct recycling of PIN1 between the plasma membrane and endosomal compartments.probableQ9C6B8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZUX, chain A
Confidence level:confident
Coverage over the Query: 432-586
View the alignment between query and template
View the model in PyMOL
Template: 3ZUX, chain A
Confidence level:probable
Coverage over the Query: 72-143
View the alignment between query and template
View the model in PyMOL