Citrus Sinensis ID: 008027


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580
MGSIVPFQDLNLMPSPSTAASTAAAATLPLLTPKIEPKTEPFDEPVPTHQLERGQNTPESLLSESAPGFFSNSENTPESQPPDRDNVYSEFYRISELFRTAFAKRLRKYGDVDVLDPDSRAIVTVTHQDAQLSNAVVPRTKPMKRSGELVRVTDLSAEDERYFRDVVRRTRMLYDSLRVFAVYEEEKRRGIGQGRRARGDLTASSVMKERQLWLNRDKRIVGSIPGVQIGDVFFFRMELLVVGLHGHSQAGIDYLPGSQSANGEPIATSIIVSGGYEDDEDAGDVLIYTGHGGQDKLSRQCEHQKLEGGNLAMERSMHYGIEVRVIRGFRYQGSVSSKVYVYDGLYKIHDCWFDVGKSGFGVYKYKLLRIEGQPEMGSAILRFADSLRTKPLSVRPKGYLSLDISGKKENVPVLLFNDIDGDYEPLYYEYLVRTVFPPFVFTQGSNGAGCDCVSGCTDRCFCAVKNGGEFAYDHNGYLLRGKPVIFECGAFCQCPPTCRNRVSQRGLRNRLEVFRSRETGWGVRSLDLIHAGAFICEYAGVVLTMEQAQIFSMNGDSLIYPNRFSARWGEWGDLSQMKIR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccccEEccccccccccEEccHHHEEHHcccccccccccccccccccccccEEEEEEEccccccccccccEEEEEcccccccccccccccccccccHHHHHHHcccccEEEEEcccccccccccEEEEccEEEEEEEEEEccccccEEEEEEHHHHccccccccHHHHHccccccccccccccccEEcccccccccccEEEEEccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEECccccEECccccccccccccccccccccEEEEEEEECccccEEEEcccccccccEEEEEEEEEEcHHHHHHHcccccEEcccccccccccccccccccccc
**SIVPFQDLNLM******************TPKIE***************************************************************************************************************************ERYFRDVVRRTRMLYDSLRVFAVYEEE******************SVMKERQLWLNRDKRIVGSIPGVQIGDVFFFRMELLVVGLHGHSQAGIDYLPGSQSANGEPIATSIIVSGGYEDDEDAGDVLIYTGHGG***************GNLAMERSMHYGIEVRVIRGFRYQGSVSSKVYVYDGLYKIHDCWFDVGKSGFGVYKYKLLRIEGQPEMGSAILRFADSLRTKPLSVRPKGYLSLDISGKKENVPVLLFNDIDGDYEPLYYEYLVRTVFPPFVFTQGSNGAGCDCVSGCTDRCFCAVKNGGEFAYDHNGYLLRGKPVIFECGAFCQCPPTCRNRVSQRGLRNRLEVFRSRETGWGVRSLDLIHAGAFICEYAGVVLTMEQAQIFSMNGDSLIYPNRFSARWGEWGDLSQM***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSIVPFQDLNLMPSPSTAASTAAAATLPLLTPKIEPKTEPFDEPVPTHQLERGQNTPESLLSESAPGFFSNSENTPESQPPDRDNVYSEFYRISELFRTAFAKRLRKYGDVDVLDPDSRAIVTVTHQDAQLSNAVVPRTKPMKRSGELVRVTDLSAEDERYFRDVVRRTRMLYDSLRVFAVYEEEKRRGIGQGRRARGDLTASSVMKERQLWLNRDKRIVGSIPGVQIGDVFFFRMELLVVGLHGHSQAGIDYLPGSQSANGEPIATSIIVSGGYEDDEDAGDVLIYTGHGGQDKLSRQCEHQKLEGGNLAMERSMHYGIEVRVIRGFRYQGSVSSKVYVYDGLYKIHDCWFDVGKSGFGVYKYKLLRIEGQPEMGSAILRFADSLRTKPLSVRPKGYLSLDISGKKENVPVLLFNDIDGDYEPLYYEYLVRTVFPPFVFTQGSNGAGCDCVSGCTDRCFCAVKNGGEFAYDHNGYLLRGKPVIFECGAFCQCPPTCRNRVSQRGLRNRLEVFRSRETGWGVRSLDLIHAGAFICEYAGVVLTMEQAQIFSMNGDSLIYPNRFSARWGEWGDLSQMKIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH9 Histone methyltransferase. Methylates 'Lys-9' of histone H3. H3 'Lys-9' methylation represents a specific tag for epigenetic transcriptional repression.probableQ9T0G7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.43Histone-lysine N-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q0B, chain X
Confidence level:very confident
Coverage over the Query: 219-378
View the alignment between query and template
View the model in PyMOL
Template: 3OLN, chain A
Confidence level:very confident
Coverage over the Query: 214-390
View the alignment between query and template
View the model in PyMOL
Template: 3HNA, chain A
Confidence level:very confident
Coverage over the Query: 396-577
View the alignment between query and template
View the model in PyMOL