Citrus Sinensis ID: 008043

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MTIVTLLVSATQLAGILVTVTVAANAFSFSRYRKKNLLPLRSPIDESADILASFNVDAEGEDEFFFGLATAPAHVEDRLNDAWLQFAEDEPRKKSYKEVLEPADALMGAAAGDGGSQQAPLPSNEVNKTKKKRKPVKLSIEAMIRGFQKYIEVDEGEEVSGENEVPTENEEVHHKVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGINYYGQEVVSGPGLKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTREDRARAWSELQLAAKQKKTRPFYRAVNKHGLMYAGGLDEPTQRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFSIIKKREPQKDDAELVVQPLQFSI
ccEEHHHHHHHHHHcEEEEEEEEcccHHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHcccccccccccccHHHHHcccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccEEcccccccccccccccccHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccHHHHHHHHHHHcccccccccEEccEEcccccccccEEccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHcccccccccccccccccHHHHcccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccccccccccEEEEEccccccHHHcHHHHHHHHHHHcccccccccccccHHHHHccccccccccccccccccccccccccccccccccccEEEEEcHHHHHccccccccccccHHHHHHcccccccccccccccEHccHccHHHHHHHHHHccccEEEEEEEcccEccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHcccccccHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHcccccccHHHHHcccccEEEEEEcccHEEccccccccccccccccccEEccHHHHHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEccEccccHHHccccccccEEEEcccccEEEEcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHEHcccccEEccccccccccccEEEccccccEEEcccccHHHHHHHHHHccccHHcccccccccccEEEcccEccc
MTIVTLLVSATQLAGILVTVTVAANafsfsryrkknllplrspidesaDILAsfnvdaegedefffglatapahvEDRLNDAWLqfaedeprkksYKEVLEPADAlmgaaagdggsqqaplpsnevnktkkkrkpVKLSIEAMIRGFQKYIevdegeevsgenevpteneevHHKVTawhnvphpeerlrfwsdpdielklakdtgvsvfrlgidwsrimpaepvnglketVNFAALERYKWIINRVRSYGMKVMLTLFHhslpawageyggwklEKTIDYFMDFTststkskvgvahhvsfmrpyglfDVTAVTLANtlttfpyvdsisdrldfiginyygqevvsgpglklvetdeysesgrgvypdglFRVLHQFHERykhlnlpfiitengvsdetdlirrpYVIEHLLAVYAAMITGVPVIGYLFWTisdnwewadgygpkfGLVAVDRannlariprpsyhlftkvvttgkvtrEDRARAWSELQLAAKQKKTRPFYRAVNKhglmyaggldeptqrpyiqrdwrfghyqmeglqdplsrlsrcilrpfsiikkrepqkddaeLVVQPLQFSI
MTIVTLLVSATQLAGILVTVTVAAnafsfsryrkknllplrspIDESADILASFNVDAEGEDEFFFGLATAPAHVEDRLNDAWLQFAEDEPRKKSYKEVLEPADALMGAAAGdggsqqaplpsnevnktkkkrkpvklsIEAMIRGFQKYIEVDEGEEVSGENEVPTENEEVHHKVtawhnvphpeerlRFWSDPDIELKLAKDTGVSVFRLGIDwsrimpaepvnglkETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGINYYGqevvsgpglKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNlariprpsyhlftkvvttgkvtreDRARAWSELQLaakqkktrpfyRAVNKHGLmyaggldeptqRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFsiikkrepqkddaelvvqplqfsi
MTIVTLLVSATQLAGILVTVTVAANAFSFSRYRKKNLLPLRSPIDESADILASFNVDAEGEDEFFFGLATAPAHVEDRLNDAWLQFAEDEPRKKSYKEVLEPadalmgaaagdggsqqaPLPSNEVNktkkkrkpvkLSIEAMIRGFQKYIEVDEGEEVSGENEVPTENEEVHHKVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDvtavtlantlttFPYVDSISDRLDFIGINYYGQEVVSGPGLKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTREDRARAWSELQLAAKQKKTRPFYRAVNKHGLMYAGGLDEPTQRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFSIIKKREPQKDDAELVVQPLQFSI
**IVTLLVSATQLAGILVTVTVAANAFSFSRYRKKNLLPLRSPIDESADILASFNVDAEGEDEFFFGLATAPAHVEDRLNDAWLQFA****************************************************IEAMIRGFQKYIEV********************HKVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGINYYGQEVVSGPGLKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTREDRARAWSELQLAAKQKKTRPFYRAVNKHGLMYAGGLDEPTQRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFSIIK********************
*TIVTLLVSATQLAGILVTVTVAANAFSFSRYRKKNLLPLRSPIDESADILASFNVDAEGEDEFFFGLATAPAHVEDRLNDAWLQF**************************************************KLSIEAMIRGFQKYIEVDEGEEVSGENEVPTENEEVHHKVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGINYYGQEVVSGPGLKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTR**********************YRAVNKHGLMYAGGLDEPTQRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFSI*************VVQPLQFS*
MTIVTLLVSATQLAGILVTVTVAANAFSFSRYRKKNLLPLRSPIDESADILASFNVDAEGEDEFFFGLATAPAHVEDRLNDAWLQFAEDEPRKKSYKEVLEPADALMGAA**********LPSN***********VKLSIEAMIRGFQKYIEVD*****************VHHKVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGINYYGQEVVSGPGLKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTREDRARAWSELQLAAKQKKTRPFYRAVNKHGLMYAGGLDEPTQRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFSIIKKREPQKDDAELVVQPLQFSI
*TIVTLLVSATQLAGILVTVTVAANAFSFSRYRKKNLLPLRSPIDESADILASFNVDAEGEDEFFFGLATAPAHVEDRLNDAWLQFAEDEP********************************************VKLSIEAMIRGFQKYIEVDEGEEVSGENEVPTENEEVHHKVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGINYYGQEVVSGPGLKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTREDRARAWSELQLAAKQKKTRPFYRAVNKHGLMYAGGLDEPTQRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFSIIKKREPQKDDAELVVQPLQFS*
ooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIVTLLVSATQLAGILVTVTVAANAFSFSRYRKKNLLPLRSPIDESADILASFNVDAEGEDEFFFGLATAPAHVEDRLNDAWLQFAEDEPRKKSYKEVLEPADALMGAAAGDGGSQQAPLPSNEVNKTKKKRKPVKLSIEAMIRGFQKYIEVDEGEEVSGENEVPTENEEVHHKVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGINYYGQEVVSGPGLKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTREDRARAWSELQLAAKQKKTRPFYRAVNKHGLMYAGGLDEPTQRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFSIIKKREPQKDDAELVVQPLQFSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query579 2.2.26 [Sep-21-2011]
Q8L6H7647 Beta-glucosidase-like SFR yes no 0.466 0.417 0.767 1e-131
Q93Y07622 Beta-glucosidase-like SFR yes no 0.512 0.477 0.699 1e-123
P22498489 Beta-galactosidase OS=Sul yes no 0.333 0.394 0.306 3e-21
P50388489 Beta-galactosidase OS=Sul N/A no 0.335 0.396 0.294 1e-20
P14288491 Beta-galactosidase OS=Sul yes no 0.359 0.423 0.288 7e-20
P22073448 Beta-glucosidase A OS=Pae yes no 0.322 0.417 0.281 1e-15
Q9M1C9577 Beta-glucosidase 30 OS=Ar no no 0.316 0.317 0.297 3e-14
O52629510 Beta-galactosidase OS=Pyr N/A no 0.246 0.280 0.300 3e-14
Q9FZE0510 Beta-glucosidase 40 OS=Ar no no 0.250 0.284 0.307 5e-14
Q9FIW4490 Beta-glucosidase 42 OS=Ar no no 0.246 0.291 0.310 9e-14
>sp|Q8L6H7|SFR2_ORYSJ Beta-glucosidase-like SFR2, chloroplastic OS=Oryza sativa subsp. japonica GN=SFR2 PE=2 SV=1 Back     alignment and function desciption
 Score =  469 bits (1208), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 221/288 (76%), Positives = 244/288 (84%)

Query: 280 DYFMDFTSTSTKSKVGVAHHVSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGIN 339
           DY    +    K  VGVAHHVSF RPYGLFDV AV LAN+LT FPYVDSI D+LDFIGIN
Sbjct: 353 DYIHSKSKNERKPIVGVAHHVSFTRPYGLFDVAAVALANSLTLFPYVDSICDKLDFIGIN 412

Query: 340 YYGQEVVSGPGLKLVETDEYSESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDE 399
           YYGQEV+SGPGLKLV+ DEYSESGRGVYPDGLFR+L QF+ERYK LN+PF+ITENGVSDE
Sbjct: 413 YYGQEVISGPGLKLVDNDEYSESGRGVYPDGLFRILIQFNERYKRLNIPFVITENGVSDE 472

Query: 400 TDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLA 459
           TDLIR+PY++EHLLA YAA+I GV V+GYLFWT SDNWEWADGYGPKFGLVAVDRANNLA
Sbjct: 473 TDLIRKPYILEHLLATYAAIIMGVRVLGYLFWTTSDNWEWADGYGPKFGLVAVDRANNLA 532

Query: 460 RIPRPSYHLFTKVVTTGKVTREDRARAWSELQLAAKQKKTRPFYRAVNKHGLMYAGGLDE 519
           R PRPSY LF++VVTTGK+TR+DR  AW ELQ AA QKKTRPF+RAV+KHG MYAGGLD 
Sbjct: 533 RKPRPSYFLFSRVVTTGKITRQDRMSAWRELQQAAVQKKTRPFFRAVDKHGRMYAGGLDR 592

Query: 520 PTQRPYIQRDWRFGHYQMEGLQDPLSRLSRCILRPFSIIKKREPQKDD 567
           P QRP+I RDWRFGHY+MEGLQDPLS   RCI  PFS  KK    +DD
Sbjct: 593 PIQRPFILRDWRFGHYKMEGLQDPLSCFIRCIFAPFSRQKKIHYIEDD 640
Potentially involved in freezing tolerance.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q93Y07|SFR2_ARATH Beta-glucosidase-like SFR2, chloroplastic OS=Arabidopsis thaliana GN=SFR2 PE=1 SV=1 Back     alignment and function description
>sp|P22498|BGAL_SULSO Beta-galactosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lacS PE=1 SV=2 Back     alignment and function description
>sp|P50388|BGAL_SULSH Beta-galactosidase OS=Sulfolobus shibatae GN=bglY PE=3 SV=1 Back     alignment and function description
>sp|P14288|BGAL_SULAC Beta-galactosidase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=bgaS PE=1 SV=2 Back     alignment and function description
>sp|P22073|BGLA_PAEPO Beta-glucosidase A OS=Paenibacillus polymyxa GN=bglA PE=1 SV=1 Back     alignment and function description
>sp|Q9M1C9|BGL30_ARATH Beta-glucosidase 30 OS=Arabidopsis thaliana GN=BGLU30 PE=2 SV=1 Back     alignment and function description
>sp|O52629|BGAL_PYRWO Beta-galactosidase OS=Pyrococcus woesei PE=1 SV=1 Back     alignment and function description
>sp|Q9FZE0|BGL40_ARATH Beta-glucosidase 40 OS=Arabidopsis thaliana GN=BGLU40 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIW4|BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana GN=BGLU42 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
255556482572 hydrolase, hydrolyzing O-glycosyl compou 0.972 0.984 0.765 0.0
225432051648 PREDICTED: beta-glucosidase-like SFR2, c 0.523 0.467 0.809 1e-144
224112028611 predicted protein [Populus trichocarpa] 0.512 0.486 0.798 1e-143
296083209619 unnamed protein product [Vitis vinifera] 0.506 0.473 0.829 1e-142
356521729637 PREDICTED: beta-glucosidase-like SFR2, c 0.516 0.469 0.785 1e-139
351724169637 beta-glycosidase-like [Glycine max] gi|9 0.516 0.469 0.778 1e-138
449462130640 PREDICTED: beta-glucosidase-like SFR2, c 0.443 0.401 0.838 1e-138
449511881640 PREDICTED: LOW QUALITY PROTEIN: beta-glu 0.443 0.401 0.838 1e-137
350540114642 beta-glycosidase-like [Solanum lycopersi 0.521 0.470 0.729 1e-132
115486639647 Os11g0683500 [Oryza sativa Japonica Grou 0.466 0.417 0.767 1e-129
>gi|255556482|ref|XP_002519275.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223541590|gb|EEF43139.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/581 (76%), Positives = 499/581 (85%), Gaps = 18/581 (3%)

Query: 1   MTIVTLLVSATQLAGILVTVTVAANAFSFSRYRKKNLLPLRSPIDESADILASFNVDAEG 60
           M    + VSA +LAG+L TVTVAAN FSF RYR+KNL    SPIDES++ILASFNV+AE 
Sbjct: 8   MAFFAIFVSAAKLAGVLATVTVAANVFSFERYRRKNLRRFNSPIDESSEILASFNVNAEE 67

Query: 61  EDEFFFGLATAPAHVEDRLNDAWLQFAEDEPRKKSYK-EVLEPADALMGAAAGDGGSQQA 119
           E+EFFFGLATAPAHVEDRLNDAWLQFA + P +KS   + LEPADALMG+A GDGGSQQA
Sbjct: 68  ENEFFFGLATAPAHVEDRLNDAWLQFAAENPCEKSQSHQGLEPADALMGSATGDGGSQQA 127

Query: 120 PLPSNEVNKTKKKRKPVKLSIEAMIRGFQKYIEVDEGEEVSGENEVPTENEEVHHKVTAW 179
            L      K K+     K ++EAMIRGF KY E          +E P  +EE HH V AW
Sbjct: 128 SLSGKVNKKKKQL----KFAMEAMIRGFYKYTE----------DEAP--HEECHHNVAAW 171

Query: 180 HNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALER 239
           HNVPHPEERL+FWSDPD ELKLAKDTG+SVFR+GIDW+RIMP EPVNGLKETVNFAA+ER
Sbjct: 172 HNVPHPEERLKFWSDPDTELKLAKDTGISVFRMGIDWTRIMPEEPVNGLKETVNFAAVER 231

Query: 240 YKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTSTSTKSKVGVAHH 299
           YKWII+RVRSYGMKVMLTLFHHSLP WAGEYGGWKLEKT+DYF++FT TS+KS VGVAHH
Sbjct: 232 YKWIISRVRSYGMKVMLTLFHHSLPPWAGEYGGWKLEKTVDYFIEFTRTSSKSIVGVAHH 291

Query: 300 VSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRLDFIGINYYGQEVVSGPGLKLVETDEY 359
           VSFMRPYG+FDV AV+LAN+LT FPYVDSISD+LD+IGINYYGQEVVSG GLKLVETDEY
Sbjct: 292 VSFMRPYGIFDVAAVSLANSLTLFPYVDSISDKLDYIGINYYGQEVVSGAGLKLVETDEY 351

Query: 360 SESGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAM 419
           SESGRGVYPDGLFR+L Q++ERYKHL LPFIITENGVSD TDLIRRPY++EHL+AVYAAM
Sbjct: 352 SESGRGVYPDGLFRMLIQYNERYKHLKLPFIITENGVSDATDLIRRPYLVEHLIAVYAAM 411

Query: 420 ITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVT 479
             G+PV+GYLFWTISDNWEWADGYGPKFGLVAVDR N LARIPRPSYHLF+KV TTGK+T
Sbjct: 412 TMGIPVLGYLFWTISDNWEWADGYGPKFGLVAVDRENGLARIPRPSYHLFSKVATTGKIT 471

Query: 480 REDRARAWSELQLAAKQKKTRPFYRAVNKHGLMYAGGLDEPTQRPYIQRDWRFGHYQMEG 539
           REDRARAW+ELQ AAK+KK RPFYRAV+KHGLMYAGGLDE   RP+++RDWRFGHY+MEG
Sbjct: 472 REDRARAWNELQRAAKEKKMRPFYRAVDKHGLMYAGGLDESVPRPFVERDWRFGHYEMEG 531

Query: 540 LQDPLSRLSRCILRPFSIIKKREPQK-DDAELVVQPLQFSI 579
           LQDP SRLSRCILRPFSI KKR+  K DD ELV QPL++++
Sbjct: 532 LQDPFSRLSRCILRPFSIKKKRKHIKDDDDELVFQPLEYAV 572

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225432051|ref|XP_002280268.1| PREDICTED: beta-glucosidase-like SFR2, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224112028|ref|XP_002316058.1| predicted protein [Populus trichocarpa] gi|222865098|gb|EEF02229.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296083209|emb|CBI22845.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356521729|ref|XP_003529504.1| PREDICTED: beta-glucosidase-like SFR2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|351724169|ref|NP_001238328.1| beta-glycosidase-like [Glycine max] gi|94466938|emb|CAJ87636.1| putative beta-glycosidase [Glycine max] Back     alignment and taxonomy information
>gi|449462130|ref|XP_004148794.1| PREDICTED: beta-glucosidase-like SFR2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449511881|ref|XP_004164079.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase-like SFR2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|350540114|ref|NP_001233879.1| beta-glycosidase-like [Solanum lycopersicum] gi|94466940|emb|CAJ87637.1| putative beta-glycosidase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|115486639|ref|NP_001068463.1| Os11g0683500 [Oryza sativa Japonica Group] gi|75301082|sp|Q8L6H7.1|SFR2_ORYSJ RecName: Full=Beta-glucosidase-like SFR2, chloroplastic; AltName: Full=Beta-glucosidase 36; Short=Os11bglu36; AltName: Full=Protein SENSITIVE TO FREEZING 2; Short=OsSFR2 gi|22090446|emb|CAD36515.1| putative beta-glycosidase [Oryza sativa Japonica Group] gi|77552496|gb|ABA95293.1| glycosyl hydrolase family 1 protein, putative, expressed [Oryza sativa Japonica Group] gi|77552497|gb|ABA95294.1| glycosyl hydrolase family 1 protein, putative, expressed [Oryza sativa Japonica Group] gi|77552498|gb|ABA95295.1| glycosyl hydrolase family 1 protein, putative, expressed [Oryza sativa Japonica Group] gi|113645685|dbj|BAF28826.1| Os11g0683500 [Oryza sativa Japonica Group] gi|125578034|gb|EAZ19256.1| hypothetical protein OsJ_34793 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
FB|FBgn0036659541 CG9701 [Drosophila melanogaste 0.217 0.232 0.365 1.2e-21
UNIPROTKB|Q9SPP9540 Q9SPP9 "Raucaffricine-O-beta-D 0.167 0.179 0.383 5.2e-21
TAIR|locus:2101427577 DIN2 "DARK INDUCIBLE 2" [Arabi 0.300 0.301 0.287 1e-20
TAIR|locus:2050497590 BGLU29 "beta glucosidase 29" [ 0.241 0.237 0.335 1.6e-20
TAIR|locus:2167479490 BGLU42 "beta glucosidase 42" [ 0.176 0.208 0.391 3.5e-20
TAIR|locus:2197960510 BGLU40 "beta glucosidase 40" [ 0.186 0.211 0.344 9.2e-20
TAIR|locus:2101417514 BGLU16 "beta glucosidase 16" [ 0.183 0.206 0.339 1.6e-19
ZFIN|ZDB-GENE-081104-4341898 si:dkey-79p17.2 "si:dkey-79p17 0.243 0.074 0.346 8.6e-19
TAIR|locus:2050615582 BGLU28 "beta glucosidase 28" [ 0.177 0.176 0.360 1e-18
WB|WBGene00016848479 klo-1 [Caenorhabditis elegans 0.145 0.175 0.418 1.6e-18
FB|FBgn0036659 CG9701 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 195 (73.7 bits), Expect = 1.2e-21, Sum P(4) = 1.2e-21
 Identities = 49/134 (36%), Positives = 68/134 (50%)

Query:   366 VYPDGLFRVLHQFHERYKHLNLP-FIITENGVSDE---TDLIRRPYVIEHLLAVYAAMIT 421
             VYP G++ +L   H  Y   N P  I+TENGVSD     D  R  Y   +L AV  AM  
Sbjct:   380 VYPKGMYNLLMWIHREY---NAPEIIVTENGVSDRGGLEDYARVDYYNLYLSAVLDAMED 436

Query:   422 GVPVIGYLFWTISDNWEWADGYGPKFGLVAVD-RANNLARIPRPSYHLFTKVVTTGKVTR 480
             G  + GY+ W++ D++EW  G+  KFGL  VD  +    R P+ S  +F ++  T  +  
Sbjct:   437 GANISGYIAWSLMDSYEWKAGFSEKFGLYHVDFNSPQRTRTPKISARVFAQLCKTNTIDW 496

Query:   481 EDRARAWSELQLAA 494
               R +   E QL A
Sbjct:   497 SYRPKLDEEQQLVA 510
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
UNIPROTKB|Q9SPP9 Q9SPP9 "Raucaffricine-O-beta-D-glucosidase" [Rauvolfia serpentina (taxid:4060)] Back     alignment and assigned GO terms
TAIR|locus:2101427 DIN2 "DARK INDUCIBLE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050497 BGLU29 "beta glucosidase 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167479 BGLU42 "beta glucosidase 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197960 BGLU40 "beta glucosidase 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101417 BGLU16 "beta glucosidase 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-434 si:dkey-79p17.2 "si:dkey-79p17.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2050615 BGLU28 "beta glucosidase 28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00016848 klo-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L6H7SFR2_ORYSJNo assigned EC number0.76730.46630.4173yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
TIGR03356426 TIGR03356, BGL, beta-galactosidase 2e-29
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 5e-28
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 5e-26
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 9e-17
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 3e-13
PRK13511469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 3e-11
TIGR01233467 TIGR01233, lacG, 6-phospho-beta-galactosidase 7e-10
PRK09589476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 1e-09
PLN02849503 PLN02849, PLN02849, beta-glucosidase 1e-09
TIGR03356426 TIGR03356, BGL, beta-galactosidase 2e-09
PLN02814504 PLN02814, PLN02814, beta-glucosidase 2e-09
PRK09852474 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi 1e-08
PRK09852474 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi 2e-08
PRK15014477 PRK15014, PRK15014, 6-phospho-beta-glucosidase Bgl 7e-08
PLN02998497 PLN02998, PLN02998, beta-glucosidase 8e-08
PRK13511469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 3e-07
PRK09589476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 2e-06
PLN02998497 PLN02998, PLN02998, beta-glucosidase 8e-06
PRK09593478 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe 1e-05
PRK09593478 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe 2e-05
PLN02849503 PLN02849, PLN02849, beta-glucosidase 1e-04
PLN02814504 PLN02814, PLN02814, beta-glucosidase 0.001
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information 
 Score =  120 bits (303), Expect = 2e-29
 Identities = 64/169 (37%), Positives = 88/169 (52%), Gaps = 22/169 (13%)

Query: 320 LTTFPYV-----DSISDRLDFIGINYYGQEVVS---GPGLKLVETD---EYSESGRGVYP 368
           L   P+V     ++I+  LDF+GINYY + VV    G G   VE       +  G  VYP
Sbjct: 261 LGDLPFVQDGDLETIAQPLDFLGINYYTRSVVKADPGAGAGFVEVPEGVPKTAMGWEVYP 320

Query: 369 DGLFRVLHQFHERYKHLNLPFIITENGVS--DET------DLIRRPYVIEHLLAVYAAMI 420
           +GL+ +L +  E Y     P  ITENG +  DE       D  R  Y+ +HL A++ A+ 
Sbjct: 321 EGLYDLLLRLKEDYP--GPPIYITENGAAFDDEVTDGEVHDPERIAYLRDHLAALHRAIE 378

Query: 421 TGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLF 469
            GV V GY  W++ DN+EWA+GY  +FGLV VD      R P+ S   +
Sbjct: 379 EGVDVRGYFVWSLLDNFEWAEGYSKRFGLVHVDYE-TQKRTPKDSALWY 426

Length = 426
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|184975 PRK15014, PRK15014, 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 579
KOG0626524 consensus Beta-glucosidase, lactase phlorizinhydro 100.0
PRK13511469 6-phospho-beta-galactosidase; Provisional 100.0
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 100.0
PLN02814504 beta-glucosidase 100.0
PLN02849503 beta-glucosidase 100.0
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 100.0
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 100.0
PLN02998497 beta-glucosidase 100.0
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 100.0
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 100.0
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 100.0
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 100.0
TIGR03356427 BGL beta-galactosidase. 100.0
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 98.78
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 98.64
PRK10150604 beta-D-glucuronidase; Provisional 98.52
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 98.29
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 97.98
PF01229486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 96.93
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 96.67
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 96.19
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 96.18
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 95.83
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 94.74
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 93.97
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 93.45
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 93.02
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 91.48
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 90.7
PLN02905702 beta-amylase 85.51
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 85.47
PLN02161531 beta-amylase 85.18
PLN02803548 beta-amylase 84.77
PLN02801517 beta-amylase 84.45
PF01373402 Glyco_hydro_14: Glycosyl hydrolase family 14; Inte 84.05
PLN00197573 beta-amylase; Provisional 83.99
PLN02705681 beta-amylase 83.68
PF00332310 Glyco_hydro_17: Glycosyl hydrolases family 17; Int 83.06
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-91  Score=754.77  Aligned_cols=310  Identities=32%  Similarity=0.541  Sum_probs=273.1

Q ss_pred             CCCCcccccc-ccccccCCCCccccccCccChHHHHHHHHhcCCCeEEecccccccccCCCCCCCccccCHHHHHHHHHH
Q 008043          165 VPTENEEVHH-KVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEPVNGLKETVNFAALERYKWI  243 (579)
Q Consensus       165 ~ps~~d~f~h-~p~~~~~~~~~d~a~d~y~~y~eDI~LmkeLGvnaYRFSIsWSRI~P~g~~~G~~g~vN~~GldfY~~L  243 (579)
                      +||+||+|+| .|++..++.++++|||+||+|+|||+|||+||+++||||||||||+|.|++   .+.||++||+||++|
T Consensus        62 g~svWD~f~~~~p~~~~~~~ngdva~D~Yh~ykeDv~Lmk~lgv~afRFSIsWSRIlP~G~~---~~gVN~~Gi~fY~~L  138 (524)
T KOG0626|consen   62 GPSVWDTFTHKYPGKICDGSNGDVAVDFYHRYKEDVKLMKELGVDAFRFSISWSRILPNGRL---TGGVNEAGIQFYNNL  138 (524)
T ss_pred             CCchhhhhhccCCcccccCCCCCeechhhhhhHHHHHHHHHcCCCeEEEEeehHhhCCCCCc---CCCcCHHHHHHHHHH
Confidence            7999999998 577888999999999999999999999999999999999999999999842   357999999999999


Q ss_pred             HHHHHHCCCEEEEEeccCCCcccccc-cCCcCChhhHHHHHHhhcc----------------------------------
Q 008043          244 INRVRSYGMKVMLTLFHHSLPAWAGE-YGGWKLEKTIDYFMDFTST----------------------------------  288 (579)
Q Consensus       244 IDeLl~~GIePiVTLyHwDLPqwL~~-yGGWln~eiVd~F~dYA~t----------------------------------  288 (579)
                      |++|+++||+|+|||||||+||+|++ ||||+|+++|++|.+||+.                                  
T Consensus       139 I~eL~~nGI~P~VTLfHwDlPq~LeDeYgGwLn~~ivedF~~yA~~CF~~fGDrVK~WiT~NEP~v~s~~gY~~G~~aPG  218 (524)
T KOG0626|consen  139 IDELLANGIEPFVTLFHWDLPQALEDEYGGWLNPEIVEDFRDYADLCFQEFGDRVKHWITFNEPNVFSIGGYDTGTKAPG  218 (524)
T ss_pred             HHHHHHcCCeEEEEEecCCCCHHHHHHhccccCHHHHHHHHHHHHHHHHHhcccceeeEEecccceeeeehhccCCCCCC
Confidence            99999999999999999999999987 9999999999999999992                                  


Q ss_pred             ------------------------------------------cCCCeEEEEeeecccccCC--cccHHHHHHHhhccC--
Q 008043          289 ------------------------------------------STKSKVGVAHHVSFMRPYG--LFDVTAVTLANTLTT--  322 (579)
Q Consensus       289 ------------------------------------------~q~g~VGia~~~~~~~P~~--~~D~~Aa~~an~~~~--  322 (579)
                                                                .|+|+|||+|+..|++|++  ..|..||.++..|..  
T Consensus       219 rCs~~~~~c~~g~s~~epYiv~HNllLAHA~Av~~yr~kyk~~Q~G~IGi~~~~~w~eP~~~s~~D~~Aa~Ra~~F~~gw  298 (524)
T KOG0626|consen  219 RCSKYVGNCSAGNSGTEPYIVAHNLLLAHAAAVDLYRKKYKKKQGGKIGIALSARWFEPYDDSKEDKEAAERALDFFLGW  298 (524)
T ss_pred             CCCcccccCCCCCCCCCcchHHHHHHHHHHHHHHHHHHhhhhhcCCeEeEEEeeeeeccCCCChHHHHHHHHHHHhhhhh
Confidence                                                      5789999999999999997  588899988765421  


Q ss_pred             ---------------------Cchh-----hhccCCccEEEEecCCCceeeCCCCcc--------------c--CC----
Q 008043          323 ---------------------FPYV-----DSISDRLDFIGINYYGQEVVSGPGLKL--------------V--ET----  356 (579)
Q Consensus       323 ---------------------~p~~-----d~Ikgs~DFiGINYYt~~~V~~~~~~~--------------v--~~----  356 (579)
                                           +|.|     .+++|+.||+|||||++.+|+......              +  ..    
T Consensus       299 ~l~p~~~GdYP~~Mk~~vg~rLP~FT~ee~~~lKGS~DFvGiNyYts~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~  378 (524)
T KOG0626|consen  299 FLEPLTFGDYPDEMKERVGSRLPKFTEEESKLLKGSYDFVGINYYTSRYVKHLKPPPDPSQPGWSTDSGVDWTLEGNDLI  378 (524)
T ss_pred             hhcccccCCcHHHHHHHhcccCCCCCHHHHHHhcCchhhceeehhhhhhhhccCCCCCCCCcccccccceeeeecccccc
Confidence                                 2322     246999999999999999887532210              0  00    


Q ss_pred             CCCCCCCC-ccCcHHHHHHHHHHHHHhCCCCCCEEEEecCCCCC-----------CccchHHHHHHHHHHHHHHHH-cCC
Q 008043          357 DEYSESGR-GVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDE-----------TDLIRRPYVIEHLLAVYAAMI-TGV  423 (579)
Q Consensus       357 ~~~s~~Gw-~i~P~GL~~lL~~l~eRY~~~n~PI~ITENG~ad~-----------~D~~Ri~YL~~hL~av~kAI~-dGV  423 (579)
                      ...+...| .++|+||+++|++++++|+  |+||||||||+++.           +|..||+|++.||.+|++||. +||
T Consensus       379 ~~~~~~~~~~v~P~Glr~~L~yiK~~Y~--np~iyItENG~~d~~~~~~~~~~~l~D~~Ri~Y~~~~L~~~~kAi~~dgv  456 (524)
T KOG0626|consen  379 GPKAGSDWLPVYPWGLRKLLNYIKDKYG--NPPIYITENGFDDLDGGTKSLEVALKDTKRIEYLQNHLQAVLKAIKEDGV  456 (524)
T ss_pred             cccccccceeeccHHHHHHHHHHHhhcC--CCcEEEEeCCCCcccccccchhhhhcchHHHHHHHHHHHHHHHHHHhcCC
Confidence            00111223 6899999999999999999  79999999999973           589999999999999999995 999


Q ss_pred             CeEEEEEeccccccCCcCCCCCeeeEEEEcCCCCCCccccchHHHHHHHHHcCCCC
Q 008043          424 PVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVT  479 (579)
Q Consensus       424 nV~GY~~WSLlDNfEW~~GY~~RFGL~~VDf~~~l~R~PK~Sa~wY~~iI~~n~i~  479 (579)
                      ||+|||+|||||||||..||+.|||||+|||.++++|+||.|++||+++++.+..+
T Consensus       457 nv~GYf~WSLmDnfEw~~Gy~~RFGlyyVDf~d~l~R~pK~Sa~wy~~fl~~~~~~  512 (524)
T KOG0626|consen  457 NVKGYFVWSLLDNFEWLDGYKVRFGLYYVDFKDPLKRYPKLSAKWYKKFLKGKVKP  512 (524)
T ss_pred             ceeeEEEeEcccchhhhcCcccccccEEEeCCCCCcCCchhHHHHHHHHHcCCCCC
Confidence            99999999999999999999999999999999889999999999999999987654

>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>PLN02905 beta-amylase Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02161 beta-amylase Back     alignment and domain information
>PLN02803 beta-amylase Back     alignment and domain information
>PLN02801 beta-amylase Back     alignment and domain information
>PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN00197 beta-amylase; Provisional Back     alignment and domain information
>PLN02705 beta-amylase Back     alignment and domain information
>PF00332 Glyco_hydro_17: Glycosyl hydrolases family 17; InterPro: IPR000490 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
4ha3_A489 Structure Of Beta-Glycosidase From Acidilobus Sacch 2e-25
1qvb_A481 Crystal Structure Of The Beta-Glycosidase From The 7e-24
1uwi_A489 Crystal Structure Of Mutated Beta-Glycosidase From 2e-22
3apg_A473 Crystal Structure Of Hyperthermophilic Beta-Glucosi 3e-22
1gow_A489 Beta-Glycosidase From Sulfolobus Solfataricus Lengt 2e-21
4eam_A489 1.70a Resolution Structure Of Apo Beta-Glycosidase 2e-21
1uwq_A489 Structure Of Beta-glycosidase From Sulfolobus Solfa 2e-21
1vff_A423 Beta-Glycosidase From Pyrococcus Horikoshii Length 2e-19
3ta9_A458 Beta-Glucosidase A From The Halothermophile H. Oren 3e-19
3ahx_A453 Crystal Structure Of Beta-Glucosidase A From Bacter 1e-16
1uyq_A447 Mutated B-Glucosidase A From Paenibacillus Polymyxa 2e-16
1bgg_A448 Glucosidase A From Bacillus Polymyxa Complexed With 4e-16
1e4i_A447 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE 4e-16
1bga_A447 Beta-Glucosidase A From Bacillus Polymyxa Length = 4e-16
1tr1_A447 Crystal Structure Of E96k Mutated Beta-glucosidase 4e-16
4a3y_A540 Crystal Structure Of Raucaffricine Glucosidase From 5e-16
3u57_A513 Structures Of Alkaloid Biosynthetic Glucosidases De 8e-16
4atd_A513 Crystal Structure Of Native Raucaffricine Glucosida 8e-16
1gnx_A479 B-Glucosidase From Streptomyces Sp Length = 479 8e-16
1qox_A449 Beta-Glucosidase From Bacillus Circulans Sp. Alkalo 2e-14
1od0_A468 Family 1 B-Glucosidase From Thermotoga Maritima Len 2e-14
4hz6_A444 Crystal Structure Of Bglb Length = 444 7e-14
3cmj_A465 Crystal Structure Of Engineered Beta-Glucosidase Fr 7e-14
3vik_A487 Crystal Structure Of Beta-Glucosidase From Termite 3e-13
3vij_A487 Crystal Structure Of Beta-Glucosidase From Termite 3e-13
3ahz_A487 Crystal Structure Of Beta-Glucosidase From Termite 3e-13
3ai0_A487 Crystal Structure Of Beta-Glucosidase From Termite 3e-13
2o9p_A454 Beta-Glucosidase B From Paenibacillus Polymyxa Leng 8e-13
2o9r_A452 Beta-Glucosidase B Complexed With Thiocellobiose Le 8e-13
1cbg_A490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 1e-12
2jie_A454 Beta-Glucosidase B From Bacillus Polymyxa Complexed 1e-12
4b3k_A479 Family 1 6-phospho-beta-d Glycosidase From Streptoc 9e-12
3gno_A488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 1e-11
3ptk_A505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 1e-11
1v03_A565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-11
1v02_A565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 2e-11
1v02_E565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 2e-11
1np2_A436 Crystal Structure Of Thermostable Beta-Glycosidase 2e-11
3aiu_A564 Crystal Structure Of Beta-Glucosidase In Rye Length 2e-11
2dga_A565 Crystal Structure Of Hexameric Beta-Glucosidase In 4e-11
3ais_A565 Crystal Structure Of A Mutant Beta-Glucosidase In W 4e-11
1ug6_A431 Structure Of Beta-Glucosidase At Atomic Resolution 7e-11
1hxj_A507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 1e-10
1e1e_A512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 1e-10
1h49_A512 Crystal Structure Of The Inactive Double Mutant Of 1e-10
1e4l_A512 Crystal Structure Of The Inactive Mutant Monocot (M 1e-10
1pbg_A468 The Three-Dimensional Structure Of 6-Phospho-Beta G 1e-10
2pbg_A468 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 1e-10
1wcg_A464 Aphid Myrosinase Length = 464 2e-10
3f4v_A481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 4e-10
2rgl_A481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 4e-10
4pbg_A468 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 9e-10
3scr_A481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 2e-09
3scp_A481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 2e-09
3zjk_A431 Crystal Structure Of Ttb-gly F401s Mutant Length = 2e-09
3scn_A481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 3e-09
3scw_A481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 3e-09
2jf6_A532 Structure Of Inactive Mutant Of Strictosidine Gluco 4e-09
3ahy_A473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 5e-09
3scv_A481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 5e-09
4gxp_A467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 3e-08
3pn8_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 2e-07
4f66_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 3e-07
4f79_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 3e-07
2e3z_A465 Crystal Structure Of Intracellular Family 1 Beta- G 7e-07
2e3z_A465 Crystal Structure Of Intracellular Family 1 Beta- G 1e-05
3qom_A481 Crystal Structure Of 6-Phospho-Beta-Glucosidase Fro 1e-06
1e6q_M501 Myrosinase From Sinapis Alba With The Bound Transit 2e-06
1dwa_M499 Study On Radiation Damage On A Cryocooled Crystal. 2e-06
1myr_A501 Myrosinase From Sinapis Alba Length = 501 2e-06
2e9l_A469 Crystal Structure Of Human Cytosolic Neutral Beta-G 2e-06
2e9l_A469 Crystal Structure Of Human Cytosolic Neutral Beta-G 5e-04
2zox_A469 Crystal Structure Of The Covalent Intermediate Of H 2e-06
2zox_A469 Crystal Structure Of The Covalent Intermediate Of H 5e-04
2jfe_X469 The Crystal Structure Of Human Cytosolic Beta-Gluco 2e-06
2jfe_X469 The Crystal Structure Of Human Cytosolic Beta-Gluco 6e-04
2xhy_A479 Crystal Structure Of E.Coli Bgla Length = 479 3e-05
>pdb|4HA3|A Chain A, Structure Of Beta-Glycosidase From Acidilobus Saccharovorans In Complex With Tris Length = 489 Back     alignment and structure 
Iteration: 1

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 102/171 (59%), Gaps = 20/171 (11%)
Query: 327 DSISDRLDFIGINYYGQEVVS--GPGLKLV-------ETDEYSESGRGV-------YPDG 370
           D +  RLD+IG+NYY ++VV   G G ++V       E +  S +GR         YP+G
Sbjct: 305 DDLKGRLDWIGVNYYTRQVVRARGSGYEIVPGYGHGCEPNGVSPAGRPCSDFGWEFYPEG 364
Query: 371 LFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLF 430
           L+ VL ++ +RY   +LP ++TENG++DE D  R  Y++ H+  V+ A+  GV VIGYL 
Sbjct: 365 LYNVLKEYWDRY---HLPLLVTENGIADEGDYQRPYYLVSHVYQVHRALQDGVNVIGYLH 421
Query: 431 WTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTRE 481
           W+++DN+EWA G+  +FGL+ VD +       RPS  ++ ++  +  +T E
Sbjct: 422 WSLADNYEWASGFSKRFGLLMVDYSTKRLHW-RPSAFIYREIAKSRAITDE 471
>pdb|1QVB|A Chain A, Crystal Structure Of The Beta-Glycosidase From The Hyperthermophile Thermosphaera Aggregans Length = 481 Back     alignment and structure
>pdb|1UWI|A Chain A, Crystal Structure Of Mutated Beta-Glycosidase From Sulfolobus Solfataricus, Working At Moderate Temperature Length = 489 Back     alignment and structure
>pdb|3APG|A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus Length = 473 Back     alignment and structure
>pdb|1GOW|A Chain A, Beta-Glycosidase From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|4EAM|A Chain A, 1.70a Resolution Structure Of Apo Beta-Glycosidase (W33g) From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|1UWQ|A Chain A, Structure Of Beta-glycosidase From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|1VFF|A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii Length = 423 Back     alignment and structure
>pdb|3TA9|A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii Length = 458 Back     alignment and structure
>pdb|3AHX|A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans Length = 453 Back     alignment and structure
>pdb|1UYQ|A Chain A, Mutated B-Glucosidase A From Paenibacillus Polymyxa Showing Increased Stability Length = 447 Back     alignment and structure
>pdb|1BGG|A Chain A, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate Length = 448 Back     alignment and structure
>pdb|1E4I|A Chain A, 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE Complex Of The Beta-Glucosidase From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1BGA|A Chain A, Beta-Glucosidase A From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1TR1|A Chain A, Crystal Structure Of E96k Mutated Beta-glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance Length = 447 Back     alignment and structure
>pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 Back     alignment and structure
>pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 Back     alignment and structure
>pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 Back     alignment and structure
>pdb|1GNX|A Chain A, B-Glucosidase From Streptomyces Sp Length = 479 Back     alignment and structure
>pdb|1QOX|A Chain A, Beta-Glucosidase From Bacillus Circulans Sp. Alkalophilus Length = 449 Back     alignment and structure
>pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 Back     alignment and structure
>pdb|4HZ6|A Chain A, Crystal Structure Of Bglb Length = 444 Back     alignment and structure
>pdb|3CMJ|A Chain A, Crystal Structure Of Engineered Beta-Glucosidase From Soil Metagenome Length = 465 Back     alignment and structure
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|2O9P|A Chain A, Beta-Glucosidase B From Paenibacillus Polymyxa Length = 454 Back     alignment and structure
>pdb|2O9R|A Chain A, Beta-Glucosidase B Complexed With Thiocellobiose Length = 452 Back     alignment and structure
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|2JIE|A Chain A, Beta-Glucosidase B From Bacillus Polymyxa Complexed With 2- F-Glucose Length = 454 Back     alignment and structure
>pdb|4B3K|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus Pyogenes Length = 479 Back     alignment and structure
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure
>pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1NP2|A Chain A, Crystal Structure Of Thermostable Beta-Glycosidase From Thermophilic Eubacterium Thermus Nonproteolyticus Hg102 Length = 436 Back     alignment and structure
>pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 Back     alignment and structure
>pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 Back     alignment and structure
>pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 Back     alignment and structure
>pdb|1UG6|A Chain A, Structure Of Beta-Glucosidase At Atomic Resolution From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure
>pdb|1PBG|A Chain A, The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis Length = 468 Back     alignment and structure
>pdb|2PBG|A Chain A, 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 Back     alignment and structure
>pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|4PBG|A Chain A, 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3ZJK|A Chain A, Crystal Structure Of Ttb-gly F401s Mutant Length = 431 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|3PN8|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 Length = 480 Back     alignment and structure
>pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 In Complex With Beta-D-Glucose-6-Phosphate. Length = 480 Back     alignment and structure
>pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant (E375q) In Complex With Salicin 6-Phosphate Length = 480 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|3QOM|A Chain A, Crystal Structure Of 6-Phospho-Beta-Glucosidase From Lactobacillus Plantarum Length = 481 Back     alignment and structure
>pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 Back     alignment and structure
>pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 Back     alignment and structure
>pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2XHY|A Chain A, Crystal Structure Of E.Coli Bgla Length = 479 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 2e-57
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 8e-44
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 4e-12
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 2e-42
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 1e-12
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 3e-38
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 3e-11
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 9e-38
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 7e-14
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 5e-37
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 2e-10
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 8e-37
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 5e-11
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 1e-36
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 5e-12
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 2e-36
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 6e-11
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 2e-36
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 2e-11
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 1e-35
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 3e-10
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 2e-35
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 4e-11
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 4e-35
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 8e-13
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 6e-35
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 2e-10
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 1e-34
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 3e-11
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 2e-34
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 5e-13
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 6e-34
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 5e-12
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 8e-34
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 6e-11
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 9e-34
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 3e-11
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 1e-33
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 8e-11
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 1e-33
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 2e-10
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 2e-33
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 2e-12
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 7e-33
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 4e-11
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 9e-33
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 3e-11
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-32
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 7e-12
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 2e-32
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 1e-11
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 3e-32
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 1e-10
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 1e-31
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 5e-10
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 2e-31
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 6e-14
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 2e-14
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 3e-13
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 3e-14
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 3e-13
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 3e-14
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 6e-08
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 1e-07
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 3e-07
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 6e-07
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 1e-06
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 2e-06
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 3e-06
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 4e-06
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 6e-06
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 8e-06
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 2e-05
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 2e-05
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 3e-05
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 6e-05
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 7e-05
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 4e-04
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 4e-04
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 4e-04
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 5e-04
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 5e-04
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 5e-04
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 8e-04
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
 Score =  199 bits (507), Expect = 2e-57
 Identities = 99/404 (24%), Positives = 146/404 (36%), Gaps = 126/404 (31%)

Query: 196 DIELKLAKDTGVSVFRLGIDWSRIMP------------------------AEPVNGLKET 231
           D ++  A+  G+   R GI+W+RI P                           +  L++ 
Sbjct: 65  DHDI--AEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKI 122

Query: 232 VNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAW------------AGEYGGWKLEKTI 279
            N  ALE Y+ I +  +  G   +L L+H  LP W                 GW  EKT+
Sbjct: 123 ANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDRAPAGWLDEKTV 182

Query: 280 DYFMDFTS--------------------------------------TSTKSKVGVAHH-- 299
             F+ F +                                       S ++      +  
Sbjct: 183 VEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLRSGFPPGYLSFEAAEKAKFNLI 242

Query: 300 ------VSFMRPYGLFDVTAVTLANTLTTFPYVDSISDRL-------------------- 333
                    ++ Y    V  V         P  +   D +                    
Sbjct: 243 QAHIGAYDAIKEYSEKSV-GVIY-AFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKL 300

Query: 334 DFIGINYYGQEVVSGPGLKLVETDEY----------------SESGRGVYPDGLFRVLHQ 377
           D+IG+NYY + V       LV    Y                S+ G  +YP+GL  +L  
Sbjct: 301 DWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKY 360

Query: 378 FHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNW 437
            +  Y    LP IITENG++D  D  R  Y++ HL AVY AM  G  V GYL W+++DN+
Sbjct: 361 LNNAY---ELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNY 417

Query: 438 EWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTRE 481
           EWA G+  +FGLV VD      R  RPS  +F ++ T  ++  E
Sbjct: 418 EWAQGFRMRFGLVYVDF-ETKKRYLRPSALVFREIATQKEIPEE 460
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Length = 306 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Length = 294 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Length = 464 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 100.0
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 100.0
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 100.0
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 100.0
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 100.0
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 100.0
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 100.0
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 100.0
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 100.0
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 100.0
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 100.0
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 100.0
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 100.0
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 100.0
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 100.0
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 100.0
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 100.0
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 100.0
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 100.0
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 100.0
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 100.0
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 100.0
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 100.0
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 100.0
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 100.0
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 100.0
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 100.0
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 100.0
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 100.0
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 100.0
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 100.0
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 100.0
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 100.0
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 100.0
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.92
1uhv_A500 Beta-xylosidase; family 39 glycoside hydrolase, xy 99.85
1w91_A503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 99.82
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.66
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.61
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 99.57
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 99.56
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 99.49
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.49
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 99.44
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.44
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.41
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.39
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.38
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.36
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.34
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 99.33
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.32
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.31
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 99.29
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 99.25
1vem_A516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 99.23
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 99.2
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 99.12
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.07
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 99.07
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 98.95
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 98.95
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 98.92
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 98.88
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 98.85
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 98.85
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 98.84
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 98.81
4ekj_A500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 98.8
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 98.78
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 98.77
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 98.74
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 98.69
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 98.66
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 98.65
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 98.62
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 98.62
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 98.62
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 98.56
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 98.56
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 98.52
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 98.46
3cmg_A667 Putative beta-galactosidase; structural genomics, 98.45
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 98.4
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 98.39
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.35
3fn9_A692 Putative beta-galactosidase; structural genomics, 98.32
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 98.3
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 98.27
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 98.24
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 98.23
3d3a_A 612 Beta-galactosidase; protein structure initiative I 98.2
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.2
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 98.18
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 98.14
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 98.06
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 97.99
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 97.95
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 97.91
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 97.88
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 97.86
3gm8_A801 Glycoside hydrolase family 2, candidate beta-GLYC; 97.79
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 97.63
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 97.28
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 97.0
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 96.72
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 96.58
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 96.51
3u7v_A552 Beta-galactosidase; structural genomics, PSI-biolo 96.48
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 96.48
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 96.24
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 96.08
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 96.02
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 95.21
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 93.89
1aq0_A306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 92.87
3em5_A316 Beta-1,3-glucanase; glycoprotein, rossmann fold, ( 90.97
2cyg_A312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 90.77
1ghs_A306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 90.37
1fa2_A498 Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 88.98
1wdp_A495 Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 88.12
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 88.05
2xfr_A 535 Beta-amylase; hydrolase, carbohydrate metabolism, 86.75
3ur8_A323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 81.9
3clw_A507 Conserved exported protein; structural genomics, u 80.57
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-92  Score=776.57  Aligned_cols=353  Identities=26%  Similarity=0.492  Sum_probs=286.1

Q ss_pred             HHHhhhhhhhhcccCccccCCCCCCCCcccccc-ccccccCCCCccccccCccChHHHHHHHHhcCCCeEEecccccccc
Q 008043          142 AMIRGFQKYIEVDEGEEVSGENEVPTENEEVHH-KVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIM  220 (579)
Q Consensus       142 ~~~~~~~~~~~~~~~~~~~~~~~~ps~~d~f~h-~p~~~~~~~~~d~a~d~y~~y~eDI~LmkeLGvnaYRFSIsWSRI~  220 (579)
                      -|+=|..+.+.|.||++..+.++ |||||.|+| .|+++.+++++++||||||||+|||+|||+||+++|||||+||||+
T Consensus        25 ~FlwG~AtaA~QiEGa~~~dGkg-~SiwD~~~~~~p~~~~~~~~gdvA~D~Yhry~EDi~Lm~elG~~~yRfSIsWsRI~  103 (540)
T 4a3y_A           25 DFIMGTGSSAYQIEGGARDGGRG-PSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVL  103 (540)
T ss_dssp             TCEEEEECCHHHHCCCTTSTTCC-CBHHHHHHHHCGGGSGGGCCTTTTTCHHHHHHHHHHHHHHHTCSEEEEECCHHHHS
T ss_pred             CCeEeeechHhhhcCCcCCCCCc-ccHHHhhhccCCCcccCCCCCCcccchhHhhHHHHHHHHHcCCCEEEeeccHhhcc
Confidence            35566779999999999988887 999999998 7999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCccccCHHHHHHHHHHHHHHHHCCCEEEEEeccCCCcccccc-cCCcCChhhHHHHHHhhcc-----------
Q 008043          221 PAEPVNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGE-YGGWKLEKTIDYFMDFTST-----------  288 (579)
Q Consensus       221 P~g~~~G~~g~vN~~GldfY~~LIDeLl~~GIePiVTLyHwDLPqwL~~-yGGWln~eiVd~F~dYA~t-----------  288 (579)
                      |+|.   ..|.+|++||+||++|||+|+++||+|||||||||||+||++ ||||+|++++++|++||++           
T Consensus       104 P~G~---~~g~~N~~Gl~fY~~lid~l~~~GIeP~VTL~H~dlP~~L~~~yGGW~nr~~v~~F~~Ya~~~f~~fgdrVk~  180 (540)
T 4a3y_A          104 PGGR---LSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKH  180 (540)
T ss_dssp             TTSS---GGGCCCHHHHHHHHHHHHHHHHTTCEEEEEEESSCCBHHHHHHHCGGGSTHHHHHHHHHHHHHHHHHTTTCCE
T ss_pred             cCCC---CCCCCCHHHHHHHHHHHHHHHHcCCccceeccCCCCcHHHHhccCCcCChHHHHHHHHHHHHHHHHhccccCE
Confidence            9862   247899999999999999999999999999999999999986 7999999999999999993           


Q ss_pred             --------------------------------------------------------------------------------
Q 008043          289 --------------------------------------------------------------------------------  288 (579)
Q Consensus       289 --------------------------------------------------------------------------------  288 (579)
                                                                                                      
T Consensus       181 W~T~NEP~~~~~~gy~~G~~aPg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~a~hh~llAha~Av~~~r~~  260 (540)
T 4a3y_A          181 WMTLNEPWTFSVHGYATGLYAPGRGRTSPEHVNHPTVQHRCSTVAPQCICSTGNPGTEPYWVTHHLLLAHAAAVELYKNK  260 (540)
T ss_dssp             EEEEECHHHHHHHHHTSCCSTTCCCCC-------------------------CCTTTHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             eeEccccHHhhhhhhhhcCCCCCccccchhhhcchhhhhhhhhhhhccccccccchHHHHHHHHHHHHHhHHHHHHHHHh
Confidence                                                                                            


Q ss_pred             ---cCCCeEEEEeeecccccCCc---ccHHHHHHHhhcc-----------CCc------------h-----hhhccCCcc
Q 008043          289 ---STKSKVGVAHHVSFMRPYGL---FDVTAVTLANTLT-----------TFP------------Y-----VDSISDRLD  334 (579)
Q Consensus       289 ---~q~g~VGia~~~~~~~P~~~---~D~~Aa~~an~~~-----------~~p------------~-----~d~Ikgs~D  334 (579)
                         .+.++||++++..+++|++.   .|+.++.+.+.+.           .+|            .     ...+++++|
T Consensus       261 ~~~~~~g~IGi~~~~~~~~P~~~~~~~~~~aa~~~~~~~~~~f~dp~~~G~YP~~~~~~~~~~l~~~~~~d~~li~~~~D  340 (540)
T 4a3y_A          261 FQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYD  340 (540)
T ss_dssp             THHHHCCEEEEEEEEEEEEESSTTCHHHHHHHHHHHHHHTHHHHHHHHHSSCCHHHHHHHGGGSCCCCHHHHHHHTTCCS
T ss_pred             ccccccceEEEEecccccccCCCCcHhHHHHHHHHHHHHhcccchHHhcCCCcHHHHHHhhccCCcCCHHHHHhhcCCCC
Confidence               11368999999999999863   4566666544321           122            1     134689999


Q ss_pred             EEEEecCCCceeeCCCCcc----------------------cCCCCCCCCCC-ccCcHHHHHHHHHHHHHhCCCCCCEEE
Q 008043          335 FIGINYYGQEVVSGPGLKL----------------------VETDEYSESGR-GVYPDGLFRVLHQFHERYKHLNLPFII  391 (579)
Q Consensus       335 FiGINYYt~~~V~~~~~~~----------------------v~~~~~s~~Gw-~i~P~GL~~lL~~l~eRY~~~n~PI~I  391 (579)
                      |||||||++.+|+......                      .+..+.+.++| .|+|+||+.+|+++++||+  ++||||
T Consensus       341 FiGinyY~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~t~~~W~~I~P~GL~~~L~~l~~rY~--~P~I~I  418 (540)
T 4a3y_A          341 FVGLNYYTASYVTNASTNSSGSNNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYN--VPLIYV  418 (540)
T ss_dssp             EEEEEEEEEEEEEECC-------CCCHHHHTCEEEECEETTEESSCBCSSTTCBCCTHHHHHHHHHHHHHHC--CSCEEE
T ss_pred             eeEEecccceEEecCccCcccccccccccccccccccccCCCcCCCccCCCCceECHHHHHHHHHHHHHhcC--CCcEEE
Confidence            9999999999887432100                      11224567787 8999999999999999997  466999


Q ss_pred             EecCCCCC-----------CccchHHHHHHHHHHHHHHHHcCCCeEEEEEeccccccCCcCCCCCeeeEEEEcCCCCCCc
Q 008043          392 TENGVSDE-----------TDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLAR  460 (579)
Q Consensus       392 TENG~ad~-----------~D~~Ri~YL~~hL~av~kAI~dGVnV~GY~~WSLlDNfEW~~GY~~RFGL~~VDf~~~l~R  460 (579)
                      ||||+++.           +|+.||+||++||.+|++||+|||||+|||+|||||||||..||++||||||||++++++|
T Consensus       419 tENG~~~~~~~~~~~~~~i~D~~Ri~Yl~~hl~~~~~Ai~dGv~v~GY~~WSliDnfew~~Gy~kRfGliyVD~~~~~~R  498 (540)
T 4a3y_A          419 TENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFAR  498 (540)
T ss_dssp             EEECCCCCCCTTCCHHHHTCCHHHHHHHHHHHHHHHHHHHHTCCEEEEEESCSBCCCCGGGTTSSCCCSEEEETTTTTEE
T ss_pred             eCCCCCccccCCccccCccCCHHHHHHHHHHHHHHHHHHHCCCCEEEEeecChhHhhChhhhccCccceEEEcCCCCccc
Confidence            99999852           5889999999999999999999999999999999999999999999999999999888899


Q ss_pred             cccchHHHHHHHHHcCCCCchh-hhhhhHHHHHHHHhcCCC
Q 008043          461 IPRPSYHLFTKVVTTGKVTRED-RARAWSELQLAAKQKKTR  500 (579)
Q Consensus       461 ~PK~Sa~wY~~iI~~n~i~~~~-~~~~w~~l~~~a~~~~~~  500 (579)
                      +||+|++||+++|++|+..... ....-.+.++...+|++|
T Consensus       499 ~~K~S~~wy~~vi~~N~~~l~~~~~~~~~~~~~~~~~~~~~  539 (540)
T 4a3y_A          499 YPKDSAVWLMNSFHKNISKLPAVKRSIREDDEEQVSSKRLR  539 (540)
T ss_dssp             EECHHHHHHHHHHCC--------------------------
T ss_pred             ceecHHHHHHHHHHHcCCcccccccccCCChHHHHhHhhcc
Confidence            9999999999999998764322 222223466666666654
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Back     alignment and structure
>3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* Back     alignment and structure
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Back     alignment and structure
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Back     alignment and structure
>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Back     alignment and structure
>1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 579
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 2e-36
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 3e-14
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 8e-35
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 5e-14
d1vffa1423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 4e-32
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 5e-31
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 5e-16
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 2e-30
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 6e-16
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 3e-30
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 5e-15
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 1e-29
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 5e-15
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 2e-29
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 2e-14
d1gnxa_464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 1e-28
d1gnxa_464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 5e-13
d1pbga_468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 3e-28
d1pbga_468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 2e-11
d1ug6a_426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 7e-28
d1ug6a_426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 4e-13
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 2e-27
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 4e-14
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 2e-26
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 2e-13
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 4e-12
d1kwga2393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 8e-09
d1rh9a1370 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycoper 1e-06
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 3e-06
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 2e-05
d1h4pa_408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 4e-05
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 6e-05
d2c0ha1350 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue 3e-04
d1tg7a5354 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-ter 5e-04
d1g01a_357 c.1.8.3 (A:) Alkaline cellulase K catalytic domain 5e-04
d2pb1a1394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 8e-04
d1uuqa_410 c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta 8e-04
d1wkya2297 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA 0.001
d1v0la_302 c.1.8.3 (A:) Xylanase A, catalytic core {Streptomy 0.001
d1ur4a_387 c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus lichen 0.002
d7a3ha_300 c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradh 0.003
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: beta-Glycosidase
species: Archaeon Thermosphaera aggregans [TaxId: 54254]

 Score =  139 bits (352), Expect = 2e-36
 Identities = 62/177 (35%), Positives = 94/177 (53%), Gaps = 20/177 (11%)

Query: 321 TTFPYVDSISDRLDFIGINYY----------------GQEVVSGPGLKLVETDEYSESGR 364
               Y   +++RLD++G+NYY                G   +  PG      +  S+ G 
Sbjct: 301 INVEYRRDLANRLDWLGVNYYSRLVYKIVDDKPIILHGYGFLCTPGGISPAENPCSDFGW 360

Query: 365 GVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDETDLIRRPYVIEHLLAVYAAMITGVP 424
            VYP+GL+ +L + + RY    +  I+TENGVSD  D +R  Y++ H+ +V+ A   G+P
Sbjct: 361 EVYPEGLYLLLKELYNRY---GVDLIVTENGVSDSRDALRPAYLVSHVYSVWKAANEGIP 417

Query: 425 VIGYLFWTISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVTRE 481
           V GYL W+++DN+EWA G+  KFGLV VD      R  RPS  +F ++ T   +  E
Sbjct: 418 VKGYLHWSLTDNYEWAQGFRQKFGLVMVDF-KTKKRYLRPSALVFREIATHNGIPDE 473
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 370 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 350 Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Length = 354 Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Length = 357 Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Length = 302 Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Length = 387 Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 100.0
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 100.0
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 100.0
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 100.0
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 100.0
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 100.0
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 100.0
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 100.0
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 100.0
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 100.0
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 100.0
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 100.0
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 100.0
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.96
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.69
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.69
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.49
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.35
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.34
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 99.13
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 99.02
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 99.02
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 98.9
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 98.87
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 98.75
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 98.73
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 98.68
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 98.65
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.46
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 98.44
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 98.4
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 98.39
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 98.39
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 98.39
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 98.32
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 98.21
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 98.2
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 98.06
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 98.02
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 97.98
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 97.98
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 97.88
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 97.83
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 97.77
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 97.55
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 97.52
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 97.26
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 97.11
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 96.89
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 96.81
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 96.33
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 96.32
d2cyga1312 Plant beta-glucanases {Banana (Musa acuminata), 1, 93.31
d1ghsa_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 92.09
d1aq0a_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 89.32
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 89.06
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 88.11
d1fa2a_498 beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI 87.89
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 85.74
d1wdpa1490 beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} 84.71
d1b1ya_500 beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 83.26
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Beta-glucosidase A
species: Bacillus circulans, subsp. alkalophilus [TaxId: 1397]

Probab=100.00  E-value=1.1e-91  Score=749.00  Aligned_cols=326  Identities=29%  Similarity=0.520  Sum_probs=292.0

Q ss_pred             hhhhhhhhcccCccccCCCCCCCCccccccccccccCCCCccccccCccChHHHHHHHHhcCCCeEEecccccccccCCC
Q 008043          145 RGFQKYIEVDEGEEVSGENEVPTENEEVHHKVTAWHNVPHPEERLRFWSDPDIELKLAKDTGVSVFRLGIDWSRIMPAEP  224 (579)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~~~ps~~d~f~h~p~~~~~~~~~d~a~d~y~~y~eDI~LmkeLGvnaYRFSIsWSRI~P~g~  224 (579)
                      =|..+.+.|.||++..+.++ ||+||.|+|+|+++.+++++++||||||+|+|||+|||+||+++|||||+||||+|+| 
T Consensus        11 wG~atsa~Q~EG~~~~~g~g-~s~wd~~~~~~~~~~~~~~~~~a~d~y~~y~eDi~l~~~lG~~~yRfSi~WsRi~P~g-   88 (449)
T d1qoxa_          11 WGVATAAYQIEGAYNEDGRG-MSIWDTFAHTPGKVKNGDNGNVACDSYHRVEEDVQLLKDLGVKVYRFSISWPRVLPQG-   88 (449)
T ss_dssp             EEEECCHHHHCCCTTSTTCC-CBHHHHHHHSTTTSGGGCCTTTTTCTTSCHHHHHHHHHHHTCSEEEEECCHHHHSTTS-
T ss_pred             eeeechHHHhCcCcCCCCCc-cchhhhhhcCCCcccCCCCCCcccchhhhhHHHHHHHHHcCCCEEEccCCHHHcccCC-
Confidence            36668899999999887775 9999999999999999999999999999999999999999999999999999999986 


Q ss_pred             CCCCccccCHHHHHHHHHHHHHHHHCCCEEEEEeccCCCcccccccCCcCChhhHHHHHHhhcc----------------
Q 008043          225 VNGLKETVNFAALERYKWIINRVRSYGMKVMLTLFHHSLPAWAGEYGGWKLEKTIDYFMDFTST----------------  288 (579)
Q Consensus       225 ~~G~~g~vN~~GldfY~~LIDeLl~~GIePiVTLyHwDLPqwL~~yGGWln~eiVd~F~dYA~t----------------  288 (579)
                          .|.+|++|++||+++|++|+++||+|||||||||+|+||+++|||+|++++++|.+||+.                
T Consensus        89 ----~g~~n~~~~~~Y~~~i~~l~~~gi~P~vTL~H~d~P~~l~~~gGw~~~~~~~~F~~Ya~~v~~~fgd~V~~W~T~N  164 (449)
T d1qoxa_          89 ----TGEVNRAGLDYYHRLVDELLANGIEPFCTLYHWDLPQALQDQGGWGSRITIDAFAEYAELMFKELGGKIKQWITFN  164 (449)
T ss_dssp             ----SSSCCHHHHHHHHHHHHHHHHTTCEEEEEEESSCCBHHHHTTTGGGSTHHHHHHHHHHHHHHHHHTTTCCEEEEEE
T ss_pred             ----CCCcCHHHHHHHHHHHHHHHhcCCeEEEEEecccccchhccccCcCCHHHHHHHHHHHHHHHHHhcccccceEEec
Confidence                378999999999999999999999999999999999999999999999999999999992                


Q ss_pred             ----------------------------------------------cCCCeEEEEeeecccccCC--cccHHHHHHHhhc
Q 008043          289 ----------------------------------------------STKSKVGVAHHVSFMRPYG--LFDVTAVTLANTL  320 (579)
Q Consensus       289 ----------------------------------------------~q~g~VGia~~~~~~~P~~--~~D~~Aa~~an~~  320 (579)
                                                                    .++++||++++..+++|.+  +.|+.||.+.+.+
T Consensus       165 EP~~~~~~gy~~g~~~Pg~~~~~~~~~~~~~~~~Aha~a~~~~~~~~~~~~vgi~~~~~~~~p~~~~~~d~~Aa~~~~~~  244 (449)
T d1qoxa_         165 EPWCMAFLSNYLGVHAPGNKDLQLAIDVSHHLLVAHGRAVTLFRELGISGEIGIAPNTSWAVPYRRTKEDMEACLRVNGW  244 (449)
T ss_dssp             CHHHHHHHHHTSCSSTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEEEECCCCEEEESSSCHHHHHHHHHHHHT
T ss_pred             CcceeccccccccccCcccccHHHHHHHHHHHHHHHHHHHHHHHhhCCCceeeeeccccccccCChHHHHHHHHHHHHHh
Confidence                                                          5678999999999999986  6788888766543


Q ss_pred             cC-----------Cc--------------h-----hhhccCCccEEEEecCCCceeeCCCCcc--------c-CCCCCCC
Q 008043          321 TT-----------FP--------------Y-----VDSISDRLDFIGINYYGQEVVSGPGLKL--------V-ETDEYSE  361 (579)
Q Consensus       321 ~~-----------~p--------------~-----~d~Ikgs~DFiGINYYt~~~V~~~~~~~--------v-~~~~~s~  361 (579)
                      .+           +|              .     .+.+++++||||||||++.+|+......        . ...+.++
T Consensus       245 ~~~~~~dp~~~G~yp~~~~~~~~~~~~~p~~~~~d~~~i~~~~DFlGiNyYt~~~v~~~~~~~~~~~~~~~~~~~~~~td  324 (449)
T d1qoxa_         245 SGDWYLDPIYFGEYPKFMLDWYENLGYKPPIVDGDMELIHQPIDFIGINYYTSSMNRYNPGEAGGMLSSEAISMGAPKTD  324 (449)
T ss_dssp             TTHHHHHHHHTSSCCHHHHHHHHHHTCCCCCCTTHHHHHCCCCSEEEEECSCEEEEEECSSGGGTTTTEEECCCCCCBCT
T ss_pred             hcccccCceecCCCcHHHHHHHHhccccccCCHHHHHHhcCCcccceecccccceeecCCccccCcccccccCCCCccCC
Confidence            21           12              1     2346899999999999999887532211        1 1225688


Q ss_pred             CCCccCcHHHHHHHHHHHHHhCCCCCCEEEEecCCCCC---------CccchHHHHHHHHHHHHHHHHcCCCeEEEEEec
Q 008043          362 SGRGVYPDGLFRVLHQFHERYKHLNLPFIITENGVSDE---------TDLIRRPYVIEHLLAVYAAMITGVPVIGYLFWT  432 (579)
Q Consensus       362 ~Gw~i~P~GL~~lL~~l~eRY~~~n~PI~ITENG~ad~---------~D~~Ri~YL~~hL~av~kAI~dGVnV~GY~~WS  432 (579)
                      +||+|+|+||+.+|++++++|+  ++||||||||+++.         +|..|++||++||.+|++||++||||+|||+||
T Consensus       325 ~gwei~P~Gl~~~L~~i~~~y~--~p~i~ITENG~a~~d~~~~~~~i~D~~Ri~yl~~hL~~~~~Ai~dGv~V~GY~~WS  402 (449)
T d1qoxa_         325 IGWEIYAEGLYDLLRYTADKYG--NPTLYITENGACYNDGLSLDGRIHDQRRIDYLAMHLIQASRAIEDGINLKGYMEWS  402 (449)
T ss_dssp             TSCBCCTHHHHHHHHHHHHHTT--SCCEEEEECCCCCCCCCCTTSSCCCHHHHHHHHHHHHHHHHHHHTTCCEEEEEEEC
T ss_pred             CCCeeecchhHHHHHHHHHHhC--CCeEEEeccCcccCCCCCccccccCHHHHHHHHHHHHHHHHHHHCCCCEEEEeecC
Confidence            9999999999999999999998  57899999999964         389999999999999999999999999999999


Q ss_pred             cccccCCcCCCCCeeeEEEEcCCCCCCccccchHHHHHHHHHcCCCC
Q 008043          433 ISDNWEWADGYGPKFGLVAVDRANNLARIPRPSYHLFTKVVTTGKVT  479 (579)
Q Consensus       433 LlDNfEW~~GY~~RFGL~~VDf~~~l~R~PK~Sa~wY~~iI~~n~i~  479 (579)
                      |||||||..||++|||||+|||+ +++|+||+|++||++||++|+++
T Consensus       403 l~Dn~EW~~Gy~~RFGL~~VD~~-t~~R~pK~Sa~~yk~ii~~ng~d  448 (449)
T d1qoxa_         403 LMDNFEWAEGYGMRFGLVHVDYD-TLVRTPKDSFYWYKGVISRGWLD  448 (449)
T ss_dssp             SBCCCCGGGTTSSCCCSEEEETT-TTEEEECHHHHHHHHHHHHSEEE
T ss_pred             cchhcChhhcccCccceEEECCC-CCCcccccHHHHHHHHHHhCCcC
Confidence            99999999999999999999997 58999999999999999999873
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Back     information, alignment and structure
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure