Citrus Sinensis ID: 008060


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MEGAVHGGGTTDASAFRECFSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKSVDRKTLLQESIVSMAVAGAIIGAAIGGWMNDRFGRRTSILVADFLFFVGAVIMAAAPNPGALITGRVFVGLGVGMASMTSPLYISEASPAKIRGALVSTNGFLITSGQFLSYLINLAFTRAPGTWRWMLGVAGIPALLQFILMLLLPESPRWLYRKGREEEAQAILRKVYPAHEVETEIRDLKESVDKEIEEEGSSEKINLVKLLKTRTVRRGLIAGVGLQVFQQFVGINTVMYYSPTIVQLSGFASNRTALLLSLVTSGLNAAGSIVSIYFIDRTGRKKLLVISLSGVILSLGVLSAVFHETTSHSPMVSAVETSHFSNLTCPDYSSAATADRWDCMKCLKASSPDCGFCASHSNKLFPGACLISNSTVKDLCHDESREWYTRGCPSKFGWLALVGLALYIIFFSPGMGTAPWIVNSEIYPLRFRGVCGGIAATANWISNLIVAQSFLSLTQAIGTSWTFLIFGVISVAALLFVLIFVPETKGLPIEEIEKMLELRALHFKFWEKRSLPDKSQSV
ccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHcHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHHHHHHHccccccccEEHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHccccccccccc
****************RECFSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKSVDRKTLLQESIVSMAVAGAIIGAAIGGWMNDRFGRRTSILVADFLFFVGAVIMAAAPNPGALITGRVFVGLGVGMASMTSPLYISEASPAKIRGALVSTNGFLITSGQFLSYLINLAFTRAPGTWRWMLGVAGIPALLQFILMLLLPESPRWLYRKGREEEAQAILRKVYPAHEVETEIRDL****************INLVKLLKTRTVRRGLIAGVGLQVFQQFVGINTVMYYSPTIVQLSGFASNRTALLLSLVTSGLNAAGSIVSIYFIDRTGRKKLLVISLSGVILSLGVLSAVFHETTSHSPMVSAVETSHFSNLTCPDYSSAATADRWDCMKCLKASSPDCGFCASHSNKLFPGACLISNSTVKDLCHDESREWYTRGCPSKFGWLALVGLALYIIFFSPGMGTAPWIVNSEIYPLRFRGVCGGIAATANWISNLIVAQSFLSLTQAIGTSWTFLIFGVISVAALLFVLIFVPETKGLPIEEIEKMLELR*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGAVHGGGTTDASAFRECFSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKSVDRKTLLQESIVSMAVAGAIIGAAIGGWMNDRFGRRTSILVADFLFFVGAVIMAAAPNPGALITGRVFVGLGVGMASMTSPLYISEASPAKIRGALVSTNGFLITSGQFLSYLINLAFTRAPGTWRWMLGVAGIPALLQFILMLLLPESPRWLYRKGREEEAQAILRKVYPxxxxxxxxxxxxxxxxxxxxxEGSSEKINLVKLLKTRTVRRGLIAGVGLQVFQQFVGINTVMYYSPTIVQLSGFASNRTALLLSLVTSGLNAAGSIVSIYFIDRTGRKKLLVISLSGVILSLGVLSAVFHETTSHSPMVSAVETSHFSNLTCPDYSSAATADRWDCMKCLKASSPDCGFCASHSNKLFPGACLISNSTVKDLCHDESREWYTRGCPSKFGWLALVGLALYIIFFSPGMGTAPWIVNSEIYPLRFRGVCGGIAATANWISNLIVAQSFLSLTQAIGTSWTFLIFGVISVAALLFVLIFVPETKGLPIEEIEKMLELRALHFKFWEKRSLPDKSQSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable inositol transporter 2 Plasma membrane inositol-proton symporter. Specific for several inositol epimers, such as myoinositol and scylloinositol. D-chiroinositol, mucoinositol, alloinositol and pinitol are also transported with a lower activity. Not active with galactinol and phytate.confidentQ9C757
Proton myo-inositol cotransporter H(+)-myo-inositol cotransporter. Can also transport related stereoisomers.probableQ921A2
Proton myo-inositol cotransporter H(+)-myo-inositol cotransporter. Can also transport related stereoisomers.probableQ96QE2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 24-367,453-558
View the alignment between query and template
View the model in PyMOL