Citrus Sinensis ID: 008087
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 578 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FL12 | 592 | Protease Do-like 9 OS=Ara | yes | no | 0.797 | 0.778 | 0.756 | 0.0 | |
| O82261 | 607 | Protease Do-like 2, chlor | no | no | 0.813 | 0.774 | 0.487 | 1e-130 | |
| Q9FIV6 | 586 | Protease Do-like 10, mito | no | no | 0.877 | 0.865 | 0.418 | 1e-107 | |
| Q9SHZ1 | 559 | Putative protease Do-like | no | no | 0.756 | 0.781 | 0.421 | 8e-98 | |
| Q9SHZ0 | 518 | Protease Do-like 4, mitoc | no | no | 0.761 | 0.849 | 0.424 | 4e-95 | |
| Q9FM41 | 486 | Putative protease Do-like | no | no | 0.742 | 0.882 | 0.404 | 2e-87 | |
| Q9LK71 | 560 | Putative protease Do-like | no | no | 0.730 | 0.753 | 0.380 | 5e-79 | |
| Q9LK70 | 499 | Putative protease Do-like | no | no | 0.738 | 0.855 | 0.357 | 2e-70 | |
| Q9C691 | 219 | Putative protease Do-like | no | no | 0.276 | 0.730 | 0.460 | 7e-33 | |
| Q3E8B4 | 198 | Putative Do-like 15 prote | no | no | 0.256 | 0.747 | 0.409 | 7e-26 |
| >sp|Q9FL12|DEGP9_ARATH Protease Do-like 9 OS=Arabidopsis thaliana GN=DEGP9 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 732 bits (1890), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 357/472 (75%), Positives = 401/472 (84%), Gaps = 11/472 (2%)
Query: 115 VARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV 174
V +VVP+MDAVVKVFCVHTEPNFSLPWQRKRQYSS SSGF IGGRRVLTNAHSVEH+TQV
Sbjct: 118 VVKVVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV 177
Query: 175 KLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVVGYPI 234
KLKKRGSDTKYLATVLAIGTECDIA+LTV DDEFWEGV PVEFG+LPALQDAVTVVGYPI
Sbjct: 178 KLKKRGSDTKYLATVLAIGTECDIALLTVTDDEFWEGVSPVEFGDLPALQDAVTVVGYPI 237
Query: 235 GGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSL 294
GGDTISVTSGVVSR+EILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSL
Sbjct: 238 GGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSL 297
Query: 295 KHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKG 354
KHED ENIGYVIPTPVI+HFIQDYEK+ YTGFP+LG+EWQKMENPDLR +M M++ QKG
Sbjct: 298 KHEDAENIGYVIPTPVIVHFIQDYEKHDKYTGFPVLGIEWQKMENPDLRKSMGMESHQKG 357
Query: 355 VRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAA 414
VRIRR++PTAPES+VLKPSDIILSFDG++IANDGTVPFRHGERIGFSYL+SQKYTGDSA
Sbjct: 358 VRIRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSAL 417
Query: 415 VKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSRCL--YLISVLSME--- 469
VKVLR+ +IL FNI LA H+RLIP+H G+PPSY+I+AGFVF+ YL S E
Sbjct: 418 VKVLRNKEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEF 477
Query: 470 ----RIMNMKLRSSFWTSSCIQCHNCQMSSLLWCLRSPLCLNCFNKVLAFNGNPVKNLKS 525
+++ L + + Q+ + +N +V+AFNG PVKNLK
Sbjct: 478 DAPVKLLEKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNT--QVVAFNGKPVKNLKG 535
Query: 526 LANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDLK 577
LA MVENC+DE++KF+L+YDQ+VVL TKT+K ATLDIL THCIPSAMSDDLK
Sbjct: 536 LAGMVENCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCIPSAMSDDLK 587
|
Probable serine protease. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|O82261|DEGP2_ARATH Protease Do-like 2, chloroplastic OS=Arabidopsis thaliana GN=DEGP2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9FIV6|DGP10_ARATH Protease Do-like 10, mitochondrial OS=Arabidopsis thaliana GN=DEGP10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SHZ1|DEGP3_ARATH Putative protease Do-like 3, mitochondrial OS=Arabidopsis thaliana GN=DEGP3 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SHZ0|DEGP4_ARATH Protease Do-like 4, mitochondrial OS=Arabidopsis thaliana GN=DEGP4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FM41|DGP13_ARATH Putative protease Do-like 13 OS=Arabidopsis thaliana GN=DEGP13 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LK71|DGP11_ARATH Putative protease Do-like 11, mitochondrial OS=Arabidopsis thaliana GN=DEGP11 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9LK70|DGP12_ARATH Putative protease Do-like 12, mitochondrial OS=Arabidopsis thaliana GN=DEGP12 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C691|DEGP6_ARATH Putative protease Do-like 6, chloroplastic OS=Arabidopsis thaliana GN=DEGP6 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q3E8B4|DGP15_ARATH Putative Do-like 15 protein OS=Arabidopsis thaliana GN=DEGP15 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 578 | ||||||
| 356565028 | 576 | PREDICTED: protease Do-like 9-like [Glyc | 0.935 | 0.939 | 0.696 | 0.0 | |
| 356513127 | 584 | PREDICTED: protease Do-like 9-like [Glyc | 0.953 | 0.943 | 0.693 | 0.0 | |
| 225457105 | 575 | PREDICTED: protease Do-like 9-like [Viti | 0.953 | 0.958 | 0.716 | 0.0 | |
| 449469505 | 586 | PREDICTED: protease Do-like 9-like [Cucu | 0.965 | 0.952 | 0.701 | 0.0 | |
| 147770917 | 576 | hypothetical protein VITISV_013882 [Viti | 0.949 | 0.953 | 0.713 | 0.0 | |
| 357477329 | 590 | hypothetical protein MTR_4g106730 [Medic | 0.948 | 0.928 | 0.667 | 0.0 | |
| 255540747 | 569 | serine endopeptidase degp2, putative [Ri | 0.956 | 0.971 | 0.704 | 0.0 | |
| 224133476 | 483 | predicted protein [Populus trichocarpa] | 0.820 | 0.981 | 0.801 | 0.0 | |
| 225452528 | 579 | PREDICTED: protease Do-like 9-like [Viti | 0.967 | 0.965 | 0.681 | 0.0 | |
| 46390287 | 567 | putative DegP2 protease [Oryza sativa Ja | 0.868 | 0.885 | 0.740 | 0.0 |
| >gi|356565028|ref|XP_003550747.1| PREDICTED: protease Do-like 9-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 810 bits (2093), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 427/613 (69%), Positives = 474/613 (77%), Gaps = 72/613 (11%)
Query: 1 MSEHKRKRGRKPKIPDAEKTLDLPSIAASADDDDVVFSVSNVEIIPTTTNPSISSAAATT 60
M ++KRKRGRKPK P A +TLD P+ + S+ D VFSV NVE+I TT +P
Sbjct: 1 MGDNKRKRGRKPKTP-ATETLDHPATSPSSTAMDDVFSVGNVELIDTTASPH-------- 51
Query: 61 TNNHHPDHRPRRGRPRKHPKHETPEEKPPPLPRAGHCRPAE-NGGADFA--GDV---EPG 114
HR RGRP K H P P H RP + NGG DF+ GDV P
Sbjct: 52 -------HRRLRGRPNK--PHALP-------PGRRHARPLDTNGGGDFSVPGDVVGVSPA 95
Query: 115 V----------ARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTN 164
V ARV+PAMD+VVKVFCVHTEPNFSLPWQRKRQYSSSSSGF IGGRRVLTN
Sbjct: 96 VSTEADPAAWEARVLPAMDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTN 155
Query: 165 AHSVEHYTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQ 224
AHSVEHYTQVKLKKRGSDTKYLATVLAIGTECDIAMLTV+DDEFW+G+ PVEFGELP LQ
Sbjct: 156 AHSVEHYTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVDDDEFWQGMSPVEFGELPTLQ 215
Query: 225 DAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKG 284
DAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKG
Sbjct: 216 DAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKG 275
Query: 285 KCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRV 344
CVGIAFQSLKHED ENIGYVIPTPVIMHFIQDYEKNG YTGFP+LGVEWQKMENPDLR+
Sbjct: 276 NCVGIAFQSLKHEDAENIGYVIPTPVIMHFIQDYEKNGGYTGFPILGVEWQKMENPDLRM 335
Query: 345 AMSMKADQKGVRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLV 404
A MK DQKGVRIRR+DPTAPES+VLKPSD+ILSFDG+DIANDGTVPFRHGERIGFSYL+
Sbjct: 336 ATGMKPDQKGVRIRRIDPTAPESKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLI 395
Query: 405 SQKYTGDSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSRCLYLIS 464
SQKYTGD+AA+KVLR+S IL F+I L +HRRLIP+H+KG+PPSYYIIAGFVF+ +S
Sbjct: 396 SQKYTGDNAAIKVLRNSDILKFDIKLDSHRRLIPAHSKGKPPSYYIIAGFVFT----TVS 451
Query: 465 VLSMERIMNMKLRSSFWTSSCIQCHNCQMSSLLWCL-RSP----------------LCLN 507
V LRS + + + LL + +SP +
Sbjct: 452 V--------PYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYE 503
Query: 508 CF--NKVLAFNGNPVKNLKSLANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILAT 565
F +VLAFNG PVKNLKSLA MVE+C+DE+LKFDL+YDQ+VVLRTKT+KAATLDIL+T
Sbjct: 504 DFVNTQVLAFNGQPVKNLKSLATMVESCNDEYLKFDLDYDQIVVLRTKTAKAATLDILST 563
Query: 566 HCIPSAMSDDLKN 578
HCIPSAMSDDLK+
Sbjct: 564 HCIPSAMSDDLKS 576
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356513127|ref|XP_003525265.1| PREDICTED: protease Do-like 9-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225457105|ref|XP_002280249.1| PREDICTED: protease Do-like 9-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449469505|ref|XP_004152460.1| PREDICTED: protease Do-like 9-like [Cucumis sativus] gi|449487776|ref|XP_004157795.1| PREDICTED: protease Do-like 9-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147770917|emb|CAN74170.1| hypothetical protein VITISV_013882 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357477329|ref|XP_003608950.1| hypothetical protein MTR_4g106730 [Medicago truncatula] gi|355510005|gb|AES91147.1| hypothetical protein MTR_4g106730 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255540747|ref|XP_002511438.1| serine endopeptidase degp2, putative [Ricinus communis] gi|223550553|gb|EEF52040.1| serine endopeptidase degp2, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224133476|ref|XP_002321577.1| predicted protein [Populus trichocarpa] gi|222868573|gb|EEF05704.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225452528|ref|XP_002275131.1| PREDICTED: protease Do-like 9-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|46390287|dbj|BAD15737.1| putative DegP2 protease [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 578 | ||||||
| TAIR|locus:2173727 | 592 | DEG9 "degradation of periplasm | 0.799 | 0.780 | 0.766 | 7.2e-191 | |
| TAIR|locus:2043403 | 607 | DEG2 "degradation of periplasm | 0.813 | 0.774 | 0.489 | 6.7e-120 | |
| TAIR|locus:2167468 | 586 | DEG10 "degradation of periplas | 0.593 | 0.585 | 0.517 | 1.5e-102 | |
| TAIR|locus:2018476 | 559 | DEG3 "degradation of periplasm | 0.576 | 0.595 | 0.482 | 3e-93 | |
| DICTYBASE|DDB_G0281081 | 647 | DDB_G0281081 "Protease degS" [ | 0.783 | 0.700 | 0.398 | 6.9e-86 | |
| TAIR|locus:2008286 | 219 | DEG6 "degradation of periplasm | 0.276 | 0.730 | 0.460 | 7.2e-33 | |
| TAIR|locus:504954966 | 198 | DEG16 "degradation of periplas | 0.143 | 0.419 | 0.482 | 2.2e-28 | |
| TIGR_CMR|SPO_1625 | 478 | SPO_1625 "periplasmic serine p | 0.448 | 0.541 | 0.295 | 3.1e-19 | |
| TIGR_CMR|DET_1037 | 373 | DET_1037 "serine protease, Deg | 0.5 | 0.774 | 0.306 | 1.9e-18 | |
| UNIPROTKB|Q3AG05 | 370 | CHY_0057 "Putative serine prot | 0.456 | 0.713 | 0.270 | 5.7e-18 |
| TAIR|locus:2173727 DEG9 "degradation of periplasmic proteins 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1835 (651.0 bits), Expect = 7.2e-191, Sum P(2) = 7.2e-191
Identities = 361/471 (76%), Positives = 405/471 (85%)
Query: 115 VARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV 174
V +VVP+MDAVVKVFCVHTEPNFSLPWQRKRQYSS SSGF IGGRRVLTNAHSVEH+TQV
Sbjct: 118 VVKVVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV 177
Query: 175 KLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVVGYPI 234
KLKKRGSDTKYLATVLAIGTECDIA+LTV DDEFWEGV PVEFG+LPALQDAVTVVGYPI
Sbjct: 178 KLKKRGSDTKYLATVLAIGTECDIALLTVTDDEFWEGVSPVEFGDLPALQDAVTVVGYPI 237
Query: 235 GGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSL 294
GGDTISVTSGVVSR+EILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSL
Sbjct: 238 GGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSL 297
Query: 295 KHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKG 354
KHED ENIGYVIPTPVI+HFIQDYEK+ YTGFP+LG+EWQKMENPDLR +M M++ QKG
Sbjct: 298 KHEDAENIGYVIPTPVIVHFIQDYEKHDKYTGFPVLGIEWQKMENPDLRKSMGMESHQKG 357
Query: 355 VRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAA 414
VRIRR++PTAPES+VLKPSDIILSFDG++IANDGTVPFRHGERIGFSYL+SQKYTGDSA
Sbjct: 358 VRIRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSAL 417
Query: 415 VKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSRCL--YLISVLSMERIM 472
VKVLR+ +IL FNI LA H+RLIP+H G+PPSY+I+AGFVF+ YL S E
Sbjct: 418 VKVLRNKEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEF 477
Query: 473 N--MKLRSSFWTSSCIQCHNCQMSSLLWCLRSPLCLN---CFN-KVLAFNGNPVKNLKSL 526
+ +KL + Q + Q+ + L S + + N +V+AFNG PVKNLK L
Sbjct: 478 DAPVKLLEKH-LHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKGL 536
Query: 527 ANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDLK 577
A MVENC+DE++KF+L+YDQ+VVL TKT+K ATLDIL THCIPSAMSDDLK
Sbjct: 537 AGMVENCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCIPSAMSDDLK 587
|
|
| TAIR|locus:2043403 DEG2 "degradation of periplasmic proteins 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167468 DEG10 "degradation of periplasmic proteins 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018476 DEG3 "degradation of periplasmic proteins 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281081 DDB_G0281081 "Protease degS" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008286 DEG6 "degradation of periplasmic proteins 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504954966 DEG16 "degradation of periplasmic proteins 16" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1625 SPO_1625 "periplasmic serine protease, DO/DeqQ family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1037 DET_1037 "serine protease, DegP/HtrA family" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3AG05 CHY_0057 "Putative serine protease Do" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FL12 | DEGP9_ARATH | 3, ., 4, ., 2, 1, ., - | 0.7563 | 0.7975 | 0.7787 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 578 | |||
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 2e-30 | |
| COG0265 | 347 | COG0265, DegQ, Trypsin-like serine proteases, typi | 4e-29 | |
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 1e-16 | |
| pfam00089 | 218 | pfam00089, Trypsin, Trypsin | 6e-16 | |
| TIGR02038 | 351 | TIGR02038, protease_degS, periplasmic serine pepet | 1e-13 | |
| PRK10942 | 473 | PRK10942, PRK10942, serine endoprotease; Provision | 1e-12 | |
| cd00987 | 90 | cd00987, PDZ_serine_protease, PDZ domain of tryspi | 2e-10 | |
| PRK10898 | 353 | PRK10898, PRK10898, serine endoprotease; Provision | 4e-10 | |
| PRK10139 | 455 | PRK10139, PRK10139, serine endoprotease; Provision | 3e-09 | |
| pfam13180 | 81 | pfam13180, PDZ_2, PDZ domain | 2e-07 |
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
Score = 123 bits (310), Expect = 2e-30
Identities = 88/311 (28%), Positives = 139/311 (44%), Gaps = 41/311 (13%)
Query: 135 PNFSLPWQRKRQYSSSSSGFAIG-GRRVLTNAHSVEHYT--QVKLKKRGSD-TKYLATVL 190
P+F QR+++ SG I VLTN H V+ V L SD ++ A ++
Sbjct: 45 PDFPRQ-QREQKVRGLGSGVIISADGYVLTNNHVVDGADEITVTL----SDGREFKAKLV 99
Query: 191 AIGTECDIAMLTVEDDEFWEGVLP-VEFGELPALQ--DAVTVVGYPIGGDTISVTSGVVS 247
DIA+L ++ + LP ++ G+ L+ D V +G P G +VTSG+VS
Sbjct: 100 GKDPRTDIAVLKIDAKK----NLPVIKLGDSDKLRVGDWVLAIGNPFGLGQ-TVTSGIVS 154
Query: 248 ---RIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGI--AFQSLKHEDVENI 302
R S + +Q DAAIN GNSGGP N +G+ +GI A S +V I
Sbjct: 155 ALGR----SGLGIGDYENFIQTDAAINPGNSGGPLVNLRGEVIGINTAILSPSGGNV-GI 209
Query: 303 GYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKGVRIRRVDP 362
G+ IP+ + + + + G LGV Q++ DL ++ ++ Q+G + +V P
Sbjct: 210 GFAIPSNMAKNVVDQLIEGGKVK-RGWLGVTIQEV-TSDLAKSLGLE-KQRGALVAQVLP 266
Query: 363 TAP-ESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDS 421
+P E LK D+I S +G I++ + + G + +LR
Sbjct: 267 GSPAEKAGLKAGDVITSVNGKPISSFADLRRA----------IGTLKPGKKVTLGILRKG 316
Query: 422 KILNFNITLAT 432
K +TL
Sbjct: 317 KEKTITVTLGA 327
|
This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 428 |
| >gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215708 pfam00089, Trypsin, Trypsin | Back alignment and domain information |
|---|
| >gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 578 | |||
| PRK10139 | 455 | serine endoprotease; Provisional | 100.0 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 100.0 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 100.0 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 100.0 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 100.0 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 100.0 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 100.0 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 100.0 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.91 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 99.86 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 99.68 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 99.59 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 99.54 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 99.42 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 99.41 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 99.33 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 99.22 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 99.21 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 99.08 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 99.05 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 99.03 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 99.0 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 98.82 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 98.81 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 98.75 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 98.73 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.53 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 98.52 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 98.51 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 98.46 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 98.44 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 98.43 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.34 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 98.3 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 98.25 | |
| KOG3627 | 256 | consensus Trypsin [Amino acid transport and metabo | 98.23 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 98.22 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 98.16 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 98.11 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 98.1 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 98.09 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 98.07 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 98.07 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 98.06 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 97.98 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 97.96 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 97.94 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 97.94 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 97.93 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 97.93 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 97.91 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 97.88 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 97.88 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 97.8 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 97.79 | |
| PF05579 | 297 | Peptidase_S32: Equine arteritis virus serine endop | 97.73 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 97.73 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 97.68 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 97.67 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 97.59 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 97.58 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 97.5 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 97.42 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 97.36 | |
| KOG3605 | 829 | consensus Beta amyloid precursor-binding protein [ | 97.34 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 97.28 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 97.19 | |
| KOG3129 | 231 | consensus 26S proteasome regulatory complex, subun | 97.18 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 97.16 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 97.03 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 97.0 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 96.99 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 96.99 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 96.92 | |
| PF03761 | 282 | DUF316: Domain of unknown function (DUF316) ; Inte | 96.89 | |
| KOG3834 | 462 | consensus Golgi reassembly stacking protein GRASP6 | 96.88 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 96.86 | |
| COG5640 | 413 | Secreted trypsin-like serine protease [Posttransla | 96.78 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 96.75 | |
| PF00548 | 172 | Peptidase_C3: 3C cysteine protease (picornain 3C); | 96.75 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 96.59 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 96.59 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 96.28 | |
| KOG3553 | 124 | consensus Tax interaction protein TIP1 [Cell wall/ | 96.23 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 95.77 | |
| PF09342 | 267 | DUF1986: Domain of unknown function (DUF1986); Int | 95.37 | |
| PF02122 | 203 | Peptidase_S39: Peptidase S39; InterPro: IPR000382 | 95.36 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 95.31 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 95.07 | |
| KOG3550 | 207 | consensus Receptor targeting protein Lin-7 [Extrac | 94.94 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 93.95 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 93.68 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 93.22 | |
| PF00947 | 127 | Pico_P2A: Picornavirus core protein 2A; InterPro: | 93.21 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 92.79 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 92.69 | |
| KOG3605 | 829 | consensus Beta amyloid precursor-binding protein [ | 92.66 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 92.35 | |
| KOG3553 | 124 | consensus Tax interaction protein TIP1 [Cell wall/ | 91.97 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 91.96 | |
| PF00944 | 158 | Peptidase_S3: Alphavirus core protein ; InterPro: | 91.49 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 91.28 | |
| KOG3129 | 231 | consensus 26S proteasome regulatory complex, subun | 90.24 | |
| KOG1892 | 1629 | consensus Actin filament-binding protein Afadin [C | 89.64 | |
| KOG2921 | 484 | consensus Intramembrane metalloprotease (sterol-re | 87.61 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 86.98 | |
| KOG3550 | 207 | consensus Receptor targeting protein Lin-7 [Extrac | 86.31 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 85.82 | |
| PF05580 | 218 | Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR | 85.64 | |
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 85.19 | |
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 83.29 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 83.22 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 80.1 |
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-57 Score=490.06 Aligned_cols=387 Identities=21% Similarity=0.294 Sum_probs=310.5
Q ss_pred cccccccCCCCcEEEEeeeeCCC-------------CCCccccCCCcceEEEEEEEc--CCEEEecccccCCCceEEEEE
Q 008087 114 GVARVVPAMDAVVKVFCVHTEPN-------------FSLPWQRKRQYSSSSSGFAIG--GRRVLTNAHSVEHYTQVKLKK 178 (578)
Q Consensus 114 ~~~~~~~~~~sVV~I~~~~~~~~-------------~~~p~~~~~~~~~~GsGfvI~--~g~ILT~aHvV~~~~~i~V~~ 178 (578)
....++++.+|||.|........ ...||+......+.||||||+ +||||||+|||.++..+.|++
T Consensus 42 ~~~~~~~~~pavV~i~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSG~ii~~~~g~IlTn~HVv~~a~~i~V~~ 121 (455)
T PRK10139 42 LAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIIDAAKGYVLTNNHVINQAQKISIQL 121 (455)
T ss_pred HHHHHHHhCCcEEEEEEEEeecccccCchhHHHhccccCCccccccccceEEEEEEECCCCEEEeChHHhCCCCEEEEEE
Confidence 35667788889999987653221 012343334456799999996 599999999999999999999
Q ss_pred cCCCcEEEEEEEEEcCCCCEEEEEEeeCCCCCCeeeEEcCCCC--CCCCcEEEEeecCCCCcceEEEeEEeceeeeeecC
Q 008087 179 RGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELP--ALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYVH 256 (578)
Q Consensus 179 ~~~g~~~~a~vv~~d~~~DlAlLkv~~~~~~~~~~~l~l~~~~--~~g~~V~~iG~p~g~~~~sv~~G~Is~~~~~~~~~ 256 (578)
.|++.|+|++++.|+.+||||||++... .+++++|+++. .+|++|+++|||+|+.. +++.|+||++.+.....
T Consensus 122 -~dg~~~~a~vvg~D~~~DlAvlkv~~~~---~l~~~~lg~s~~~~~G~~V~aiG~P~g~~~-tvt~GivS~~~r~~~~~ 196 (455)
T PRK10139 122 -NDGREFDAKLIGSDDQSDIALLQIQNPS---KLTQIAIADSDKLRVGDFAVAVGNPFGLGQ-TATSGIISALGRSGLNL 196 (455)
T ss_pred -CCCCEEEEEEEEEcCCCCEEEEEecCCC---CCceeEecCccccCCCCEEEEEecCCCCCC-ceEEEEEccccccccCC
Confidence 5999999999999999999999998643 68899999865 56999999999999776 89999999987753221
Q ss_pred CceeeeEEEEecCCCCCCccceEEccCCeEEEEEecccccc-ccCCceeeecchhHHHHHHHHHHcCceeccccCCcccc
Q 008087 257 GSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHE-DVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQ 335 (578)
Q Consensus 257 ~~~~~~~i~~da~i~~G~SGGPlvn~~G~vVGI~~~~~~~~-~~~~~~~aiPi~~i~~~l~~l~~~g~v~~~~~lGi~~~ 335 (578)
.....+||+|+++++|||||||||.+|+||||+++.+..+ +..+++||||++.+++++++|+++|++. |+|||+.++
T Consensus 197 -~~~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~gigfaIP~~~~~~v~~~l~~~g~v~-r~~LGv~~~ 274 (455)
T PRK10139 197 -EGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIK-RGLLGIKGT 274 (455)
T ss_pred -CCcceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCccceEEEEEhHHHHHHHHHHhhcCccc-ccceeEEEE
Confidence 1234689999999999999999999999999999876543 3578999999999999999999999998 999999999
Q ss_pred cccChhhhhhhccccCCCCcEEEEeCCCCcccC-CCCCCCEEEEECCEEeCCCCCCccccCcchhHHHHHhccCCCCEEE
Q 008087 336 KMENPDLRVAMSMKADQKGVRIRRVDPTAPESE-VLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAA 414 (578)
Q Consensus 336 ~~~~~~~~~~lgl~~~~~Gv~V~~V~p~spA~~-GL~~GDiIl~InG~~V~~~~~v~~~~~~~~~~~~~~~~~~~g~~v~ 414 (578)
.+ ++++++.+|++. ..|++|..|.++|||++ |||+||+|++|||++|.+|.+ +...+.....|+++.
T Consensus 275 ~l-~~~~~~~lgl~~-~~Gv~V~~V~~~SpA~~AGL~~GDvIl~InG~~V~s~~d----------l~~~l~~~~~g~~v~ 342 (455)
T PRK10139 275 EM-SADIAKAFNLDV-QRGAFVSEVLPNSGSAKAGVKAGDIITSLNGKPLNSFAE----------LRSRIATTEPGTKVK 342 (455)
T ss_pred EC-CHHHHHhcCCCC-CCceEEEEECCCChHHHCCCCCCCEEEEECCEECCCHHH----------HHHHHHhcCCCCEEE
Confidence 99 899999999975 67999999999999999 999999999999999999988 556676667889999
Q ss_pred EEEEECCEEEEEEEEecccccccCCCCCCCCCCceeeccEEEeehHHHHHHhchhhhhhhhhccccccccccccCCCceE
Q 008087 415 VKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSRCLYLISVLSMERIMNMKLRSSFWTSSCIQCHNCQMS 494 (578)
Q Consensus 415 l~V~R~g~~~~~~v~l~~~~~~~~~~~~~~~p~~~~~~Gl~~~~~p~~~~~~g~~~~~~~~~l~~~~~~~~~~~~~~~~v 494 (578)
++|+|+|+.+++++++.......... ....| .+.|+.+.+. .+ .....++
T Consensus 343 l~V~R~G~~~~l~v~~~~~~~~~~~~-~~~~~---~~~g~~l~~~-----~~---------------------~~~~~Gv 392 (455)
T PRK10139 343 LGLLRNGKPLEVEVTLDTSTSSSASA-EMITP---ALQGATLSDG-----QL---------------------KDGTKGI 392 (455)
T ss_pred EEEEECCEEEEEEEEECCCCCccccc-ccccc---cccccEeccc-----cc---------------------ccCCCce
Confidence 99999999999999875432211100 00000 0223322210 00 0011345
Q ss_pred EEEe----ecCCcCCCCCCCEEEEeCCeecCCHHHHHHHHHhcCCCeEEEEEecCeEEEE
Q 008087 495 SLLW----CLRSPLCLNCFNKVLAFNGNPVKNLKSLANMVENCDDEFLKFDLEYDQVVVL 550 (578)
Q Consensus 495 vvs~----v~A~~aGl~~GD~I~~VNG~~V~~~~~l~~~l~~~~~~~v~l~v~R~~~~~l 550 (578)
++.. ++|+++||++||+|++|||++|.+|++|.+++++.+ +.+.|++.|+++.++
T Consensus 393 ~V~~V~~~spA~~aGL~~GD~I~~Ing~~v~~~~~~~~~l~~~~-~~v~l~v~R~g~~~~ 451 (455)
T PRK10139 393 KIDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAAKP-AIIALQIVRGNESIY 451 (455)
T ss_pred EEEEeCCCChHHHcCCCCCCEEEEECCEEcCCHHHHHHHHHhCC-CeEEEEEEECCEEEE
Confidence 5554 489999999999999999999999999999999865 788999999987654
|
|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3627 consensus Trypsin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans | Back alignment and domain information |
|---|
| >KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
| >PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 578 | ||||
| 4fln_A | 539 | Crystal Structure Of Plant Protease Deg2 Length = 5 | 1e-131 | ||
| 3pv2_A | 451 | Structure Of Legionella Fallonii Degq (Wt) Length = | 7e-13 | ||
| 3nzi_A | 334 | Substrate Induced Remodeling Of The Active Site Reg | 9e-13 | ||
| 3pv3_A | 451 | Structure Of Legionella Fallonii Degq (S193a Varian | 1e-12 | ||
| 3pv4_A | 354 | Structure Of Legionella Fallonii Degq (Delta-Pdz2 V | 2e-12 | ||
| 3num_A | 332 | Substrate Induced Remodeling Of The Active Site Reg | 2e-12 | ||
| 3pv5_A | 451 | Structure Of Legionella Fallonii Degq (N189gP190G V | 3e-12 | ||
| 3mh5_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 6e-12 | ||
| 2zle_A | 448 | Cryo-Em Structure Of Degp12OMP Length = 448 | 7e-12 | ||
| 3mh4_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 1e-11 | ||
| 4a8d_A | 448 | Degp Dodecamer With Bound Omp Length = 448 | 1e-11 | ||
| 3otp_A | 459 | Crystal Structure Of The Degp Dodecamer With A Mode | 2e-11 | ||
| 3cs0_A | 448 | Crystal Structure Of Degp24 Length = 448 | 1e-10 | ||
| 3nwu_A | 227 | Substrate Induced Remodeling Of The Active Site Reg | 2e-10 | ||
| 1l1j_A | 239 | Crystal Structure Of The Protease Domain Of An Atp- | 2e-10 | ||
| 3mh7_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 3e-10 | ||
| 3tjn_A | 228 | Htra1 Catalytic Domain, Apo Form Length = 228 | 3e-10 | ||
| 1ky9_A | 448 | Crystal Structure Of Degp (Htra) Length = 448 | 3e-10 | ||
| 3tjo_A | 231 | Htra1 Catalytic Domain, Mutationally Inactivated Le | 5e-10 | ||
| 3qo6_A | 348 | Crystal Structure Analysis Of The Plant Protease De | 1e-09 | ||
| 3stj_A | 345 | Crystal Structure Of The Protease + Pdz1 Domain Of | 8e-09 | ||
| 1lcy_A | 325 | Crystal Structure Of The Mitochondrial Serine Prote | 4e-08 | ||
| 4a8a_A | 436 | Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 1 | 4e-08 | ||
| 1te0_A | 318 | Structural Analysis Of Degs, A Stress Sensor Of The | 7e-07 | ||
| 1soz_A | 314 | Crystal Structure Of Degs Protease In Complex With | 8e-07 | ||
| 2as9_A | 210 | Functional And Structural Characterization Of Spl P | 2e-06 | ||
| 3gcn_A | 340 | Crystal Structure Of Degs H198pD320A MUTANT MODIFIE | 2e-06 | ||
| 1sot_A | 320 | Crystal Structure Of The Degs Stress Sensor Length | 3e-06 | ||
| 2vid_A | 204 | Serine Protease Splb From Staphylococcus Aureus At | 7e-06 | ||
| 3sti_A | 245 | Crystal Structure Of The Protease Domain Of Degq Fr | 9e-06 | ||
| 3k6y_A | 237 | Crystal Structure Of Rv3671c Protease From M. Tuber | 2e-05 | ||
| 2w7s_A | 200 | Spla Serine Protease Of Staphylococcus Aureus (1.8a | 2e-05 | ||
| 3lgy_A | 241 | R178a Mutant Of The Degs-Deltapdz Protease Length = | 2e-05 | ||
| 3k6z_A | 219 | Crystal Structure Of Rv3671c Protease, Inactive For | 3e-05 | ||
| 3lgt_A | 241 | Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease | 3e-05 | ||
| 3lgv_A | 241 | H198p Mutant Of The Degs-Deltapdz Protease Length = | 3e-05 | ||
| 3lgu_A | 241 | Y162a Mutant Of The Degs-Deltapdz Protease Length = | 3e-05 | ||
| 2qgr_A | 243 | Structure Of The R178a Mutant Of Delta Pdz Degs Pro | 4e-05 | ||
| 3lgi_A | 237 | Structure Of The Protease Domain Of Degs (Degs-Delt | 4e-05 | ||
| 2qf3_A | 243 | Structure Of The Delta Pdz Truncation Of The Degs P | 5e-05 | ||
| 2r3u_A | 211 | Crystal Structure Of The Pdz Deletion Mutant Of Deg | 6e-05 | ||
| 3lt3_A | 217 | Crystal Structure Of Rv3671c From M. Tuberculosis H | 6e-05 | ||
| 3lgw_A | 241 | H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease | 7e-05 | ||
| 2qf0_A | 243 | Structure Of The Delta Pdz Truncation Of The Degs P | 1e-04 | ||
| 3lh3_A | 241 | Dfp Modified Degs Delta Pdz Length = 241 | 1e-04 | ||
| 2rce_A | 243 | Dfp Modified Degs Delta Pdz Length = 243 | 2e-04 | ||
| 3lh1_A | 241 | Q191a Mutant Of The Degs-Deltapdz Length = 241 | 2e-04 | ||
| 1y8t_A | 324 | Crystal Structure Of Rv0983 From Mycobacterium Tube | 3e-04 | ||
| 3b8j_A | 243 | Q191a Mutant Of Degs-Deltapdz Length = 243 | 3e-04 |
| >pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 | Back alignment and structure |
|
| >pdb|3PV2|A Chain A, Structure Of Legionella Fallonii Degq (Wt) Length = 451 | Back alignment and structure |
| >pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 | Back alignment and structure |
| >pdb|3PV3|A Chain A, Structure Of Legionella Fallonii Degq (S193a Variant) Length = 451 | Back alignment and structure |
| >pdb|3PV4|A Chain A, Structure Of Legionella Fallonii Degq (Delta-Pdz2 Variant) Length = 354 | Back alignment and structure |
| >pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 | Back alignment and structure |
| >pdb|3PV5|A Chain A, Structure Of Legionella Fallonii Degq (N189gP190G VARIANT) Length = 451 | Back alignment and structure |
| >pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 | Back alignment and structure |
| >pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 | Back alignment and structure |
| >pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 | Back alignment and structure |
| >pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 | Back alignment and structure |
| >pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 | Back alignment and structure |
| >pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 | Back alignment and structure |
| >pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|3TJN|A Chain A, Htra1 Catalytic Domain, Apo Form Length = 228 | Back alignment and structure |
| >pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 | Back alignment and structure |
| >pdb|3TJO|A Chain A, Htra1 Catalytic Domain, Mutationally Inactivated Length = 231 | Back alignment and structure |
| >pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 | Back alignment and structure |
| >pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 | Back alignment and structure |
| >pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 | Back alignment and structure |
| >pdb|4A8A|A Chain A, Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 12-Mer In Complex With Lysozyme Length = 436 | Back alignment and structure |
| >pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318 | Back alignment and structure |
| >pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314 | Back alignment and structure |
| >pdb|2AS9|A Chain A, Functional And Structural Characterization Of Spl Proteases From Staphylococcus Aureus Length = 210 | Back alignment and structure |
| >pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP IN Complex With Omp Peptide (Yqf) Length = 340 | Back alignment and structure |
| >pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 | Back alignment and structure |
| >pdb|2VID|A Chain A, Serine Protease Splb From Staphylococcus Aureus At 1.8a Resolution Length = 204 | Back alignment and structure |
| >pdb|3STI|A Chain A, Crystal Structure Of The Protease Domain Of Degq From Escherichia Coli Length = 245 | Back alignment and structure |
| >pdb|3K6Y|A Chain A, Crystal Structure Of Rv3671c Protease From M. Tuberculosis, Active Form Length = 237 | Back alignment and structure |
| >pdb|2W7S|A Chain A, Spla Serine Protease Of Staphylococcus Aureus (1.8a) Length = 200 | Back alignment and structure |
| >pdb|3LGY|A Chain A, R178a Mutant Of The Degs-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|3K6Z|A Chain A, Crystal Structure Of Rv3671c Protease, Inactive Form Length = 219 | Back alignment and structure |
| >pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|3LGU|A Chain A, Y162a Mutant Of The Degs-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|2QGR|A Chain A, Structure Of The R178a Mutant Of Delta Pdz Degs Protease Length = 243 | Back alignment and structure |
| >pdb|3LGI|A Chain A, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237 | Back alignment and structure |
| >pdb|2QF3|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 | Back alignment and structure |
| >pdb|2R3U|A Chain A, Crystal Structure Of The Pdz Deletion Mutant Of Degs Length = 211 | Back alignment and structure |
| >pdb|3LT3|A Chain A, Crystal Structure Of Rv3671c From M. Tuberculosis H37rv, Ser343ala Mutant, Inactive Form Length = 217 | Back alignment and structure |
| >pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|2QF0|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 | Back alignment and structure |
| >pdb|3LH3|A Chain A, Dfp Modified Degs Delta Pdz Length = 241 | Back alignment and structure |
| >pdb|2RCE|A Chain A, Dfp Modified Degs Delta Pdz Length = 243 | Back alignment and structure |
| >pdb|3LH1|A Chain A, Q191a Mutant Of The Degs-Deltapdz Length = 241 | Back alignment and structure |
| >pdb|1Y8T|A Chain A, Crystal Structure Of Rv0983 From Mycobacterium Tuberculosis- Proteolytically Active Form Length = 324 | Back alignment and structure |
| >pdb|3B8J|A Chain A, Q191a Mutant Of Degs-Deltapdz Length = 243 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 | Back alignment and structure |
|---|
Score = 225 bits (576), Expect = 7e-71
Identities = 45/216 (20%), Positives = 82/216 (37%), Gaps = 30/216 (13%)
Query: 131 VHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYT-QVKLKKRGSDTKY---- 185
+ + P+ ++GF IG ++TN H + Y ++ + K
Sbjct: 6 TQVKDTNNFPYNGVVS-FKDATGFVIGKNTIITNKHVSKDYKVGDRITAHPNGDKGNGGI 64
Query: 186 --LATVLAIGTECDIAMLTVEDD---------EFWEGVLPVEFGELPALQDAVTVVGYPI 234
+ ++ + DI+++ +E+ F E V F + + D + V+GYP+
Sbjct: 65 YKIKSISDYPGDEDISVMNIEEQAVERGPKGFNFNENVQAFNFAKDAKVDDKIKVIGYPL 124
Query: 235 GGD---TISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAF 291
++G + RI+ L DA I GNSG P N + +G+ +
Sbjct: 125 PAQNSFKQFESTGTIKRIKDNI----------LNFDAYIEPGNSGSPVLNSNNEVIGVVY 174
Query: 292 QSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGF 327
+ E G V TP I FIQ + + +
Sbjct: 175 GGIGKIGSEYNGAVYFTPQIKDFIQKHIEQHHHHHH 210
|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198 | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Length = 213 | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 578 | |||
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 100.0 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 100.0 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 100.0 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 100.0 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 100.0 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 100.0 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 100.0 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 100.0 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 100.0 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 100.0 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 100.0 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 100.0 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.97 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.96 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.95 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.9 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.89 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 99.83 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.81 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 99.81 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.79 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 99.79 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 99.78 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 99.76 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 99.74 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.72 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 99.7 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.7 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 99.68 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 99.67 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.66 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 99.62 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 99.62 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 99.61 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 99.6 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 99.59 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 99.54 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 99.5 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 99.5 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 99.48 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 99.48 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 99.47 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 99.47 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 99.46 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 99.46 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 99.46 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 99.46 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 99.45 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 99.44 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 99.44 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 99.44 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 99.44 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 99.43 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 99.43 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 99.43 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 99.43 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 99.42 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 99.42 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 99.42 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 99.42 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 99.41 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 99.41 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 99.4 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 99.4 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 99.4 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 99.4 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 99.4 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 99.4 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 99.39 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 99.39 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 99.39 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 99.39 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 99.39 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 99.38 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 99.38 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 99.38 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 99.38 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 99.38 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 99.38 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 99.38 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 99.37 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 99.37 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 99.36 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 99.36 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 99.36 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 99.36 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 99.36 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 99.36 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 99.36 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 99.35 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 99.35 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 99.35 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 99.35 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 99.35 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 99.34 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 99.34 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 99.33 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 99.33 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 99.33 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 99.33 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 99.33 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 99.32 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 99.32 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 99.32 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 99.31 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 99.31 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 99.31 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 99.31 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 99.3 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 99.3 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 99.3 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 99.3 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 99.29 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 99.29 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 99.28 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 99.28 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 99.28 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 99.27 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 99.26 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 99.26 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 99.24 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 99.22 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 99.2 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 99.19 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 99.19 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 99.19 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 99.18 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 99.17 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 99.17 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 99.17 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.16 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 99.16 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 99.16 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 99.14 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 99.13 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 99.12 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 99.1 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 99.09 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 99.08 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 99.08 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 99.02 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 99.0 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 98.97 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 98.95 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 98.92 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 98.92 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 98.87 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 98.87 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 98.85 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 98.85 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 98.81 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 98.81 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 98.81 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 98.81 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 98.81 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.8 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 98.79 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 98.76 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 98.73 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 98.73 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.72 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 98.71 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 98.7 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 98.69 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 98.68 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 98.67 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 98.67 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.65 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.64 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 98.64 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 98.63 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.62 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 98.62 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 98.61 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 98.61 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 98.6 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 98.59 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.59 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 98.59 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 98.59 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.58 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.57 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 98.57 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.57 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 98.57 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 98.56 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 98.56 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 98.55 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 98.55 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.53 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.53 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 98.52 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 98.51 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 98.51 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 98.51 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 98.5 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 98.5 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.5 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 98.5 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 98.5 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 98.49 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 98.49 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 98.48 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 98.48 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 98.48 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 98.47 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 98.47 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 98.47 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 98.47 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 98.45 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.45 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 98.45 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 98.45 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 98.45 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 98.44 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 98.44 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 98.44 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 98.44 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 98.44 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 98.44 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 98.43 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 98.42 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.42 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.42 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 98.41 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.41 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.41 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 98.41 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 98.4 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.4 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 98.39 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 98.39 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 98.39 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 98.39 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.38 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.38 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 98.38 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 98.38 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 98.37 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 98.37 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 98.37 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 98.36 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 98.36 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.36 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 98.35 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 98.35 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 98.35 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 98.35 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 98.35 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 98.35 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 98.34 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 98.33 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 98.33 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 98.33 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.32 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.31 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 98.31 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 98.31 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 98.31 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 98.3 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 98.3 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 98.29 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 98.29 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 98.29 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 98.28 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 98.28 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 98.28 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 98.28 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 98.28 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 98.28 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 98.28 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 98.27 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.26 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.26 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 98.26 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.26 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 98.25 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 98.25 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 98.24 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 98.24 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 98.24 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 98.23 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 98.23 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 98.23 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 98.22 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 98.22 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 98.22 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 98.21 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 98.2 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.2 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 98.2 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 98.19 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 98.19 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 98.18 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.18 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 98.18 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 98.18 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 98.18 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 98.18 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 98.18 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 98.17 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 98.17 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.16 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 98.16 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.16 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 98.16 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 98.16 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 98.16 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 98.15 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.15 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 98.15 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 98.15 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 98.15 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 98.14 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 98.14 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.14 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.14 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 98.14 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.14 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 98.14 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 98.13 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 98.12 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 98.11 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.11 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 98.11 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 98.1 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.08 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 98.08 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.07 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 98.07 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 98.07 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 98.06 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 98.06 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 98.06 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 98.05 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 98.05 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 98.05 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.04 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.04 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 98.04 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 98.04 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 98.03 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 98.03 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 98.02 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 98.02 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 98.02 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 98.01 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.01 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 98.01 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 98.01 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.01 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.01 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.01 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 97.99 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 97.99 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 97.99 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 97.99 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 97.98 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 97.98 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 97.98 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 97.98 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 97.98 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 97.97 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 97.97 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 97.97 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 97.97 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 97.96 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 97.96 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 97.96 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 97.96 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 97.95 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 97.95 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 97.95 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 97.95 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 97.95 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 97.95 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 97.95 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 97.94 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 97.94 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 97.94 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 97.94 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 97.94 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 97.93 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.93 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 97.93 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 97.93 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 97.93 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 97.93 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 97.92 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 97.92 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 97.91 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 97.91 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 97.9 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 97.9 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 97.9 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 97.9 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 97.9 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 97.89 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 97.89 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 97.89 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 97.88 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 97.88 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 97.88 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 97.88 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 97.88 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 97.87 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 97.87 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 97.86 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 97.86 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 97.86 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 97.85 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 97.85 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 97.85 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 97.85 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 97.84 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 97.84 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 97.84 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 97.83 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 97.83 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 97.83 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 97.82 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 97.81 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 97.81 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 97.81 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 97.81 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 97.8 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 97.8 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 97.79 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.79 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 97.79 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 97.79 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 97.79 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 97.78 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 97.78 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 97.78 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 97.78 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 97.77 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 97.77 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 97.75 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 97.74 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 97.74 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 97.73 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 97.72 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 97.72 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 97.72 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 96.88 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.7 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 97.69 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 97.69 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 97.69 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 97.69 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 97.69 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 97.68 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 97.68 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 97.68 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 97.67 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 97.67 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 97.67 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 97.66 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 97.66 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 97.66 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 97.66 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 97.65 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 97.65 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 97.65 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 97.63 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 97.63 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 97.63 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 97.63 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 97.61 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 97.59 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 97.59 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 97.58 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 97.55 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 97.55 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 97.54 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 97.54 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 97.53 | |
| 2b0f_A | 182 | Picornain 3C (protease 3C) (P3C); beta barrel, hyd | 97.51 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 97.51 | |
| 3qzr_A | 187 | 3C protein; chymotrypsin-fold, beta-ribbon, hydrol | 97.49 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 97.49 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 97.49 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 97.43 | |
| 3q3y_A | 191 | HEVB EV93 3C protease; cysteine trypsin-like prote | 97.42 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 97.4 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 97.4 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 97.34 | |
| 2pka_A | 80 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 97.32 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 97.31 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 97.31 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 97.28 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 97.28 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 97.28 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 97.27 | |
| 1cqq_A | 180 | Type 2 rhinovirus 3C protease; viral protein, hydr | 97.25 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 96.29 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 97.2 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 97.18 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 97.1 |
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-79 Score=666.49 Aligned_cols=455 Identities=50% Similarity=0.865 Sum_probs=409.0
Q ss_pred CCCCcEEEEeeeeCCCCCCccccCCCcceEEEEEEEcCCEEEecccccCCCceEEEEEcCCCcEEEEEEEEEcCCCCEEE
Q 008087 121 AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQVKLKKRGSDTKYLATVLAIGTECDIAM 200 (578)
Q Consensus 121 ~~~sVV~I~~~~~~~~~~~p~~~~~~~~~~GsGfvI~~g~ILT~aHvV~~~~~i~V~~~~~g~~~~a~vv~~d~~~DlAl 200 (578)
..+|||+|++....++|..||+...+..+.||||||++||||||+|||.++..+.|++.+|++.|.|++++.|+.+||||
T Consensus 46 ~~~sVV~I~~~~~~~~~~~Pw~~~~~~~s~GSGfiI~dG~IlTN~HVV~~a~~i~V~~~~dg~~~~A~vv~~D~~~DLAv 125 (539)
T 4fln_A 46 FLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIAL 125 (539)
T ss_dssp HHTTEEEEEEEECCBCSSSTTSBCCCEEEEEEEEEEETTEEEECGGGGTTEEEEEEECTTCCCCEEEEEEEEETTTTEEE
T ss_pred cCCCeEEEEEEecCCCCCCccccCCccceEEEEEEEECCEEEEChHHcCCCCeEEEEEccCCEEEEEEEEEECCCCCEEE
Confidence 34699999999999999999999999999999999999999999999999999999997799999999999999999999
Q ss_pred EEEeeCCCCCCeeeEEcCCCCCCCCcEEEEeecCCCCcceEEEeEEeceeeeeecCCceeeeEEEEecCCCCCCccceEE
Q 008087 201 LTVEDDEFWEGVLPVEFGELPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAF 280 (578)
Q Consensus 201 Lkv~~~~~~~~~~~l~l~~~~~~g~~V~~iG~p~g~~~~sv~~G~Is~~~~~~~~~~~~~~~~i~~da~i~~G~SGGPlv 280 (578)
||++...++..+.++.+++++.+|++|+++|||+++...+++.|+||++++..+..+.....+||+|+++++||||||||
T Consensus 126 Lkv~~~~~~~~~~pl~~g~~~~vGd~V~aiG~P~g~~~~tvT~GIVSa~~r~~~~~~~~~~~~IQtDAaInpGnSGGPLv 205 (539)
T 4fln_A 126 LSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAF 205 (539)
T ss_dssp EEECCSSSSTTCCCCCBCCCCCTTCEEEEEECCSSSCCCEEEEEEEEEEEEEECTTSCCEEEEEEESSCCCTTTTTSEEE
T ss_pred EEEeCCcCCcCCceeecCCcCcCCCeEEEEEcCCCCCCCcEEeEEECcccccccCCCCcceeEEEEEeEecCCCccchhc
Confidence 99998876667788999998899999999999998776699999999999887776666667899999999999999999
Q ss_pred ccCCeEEEEEeccccccccCCceeeecchhHHHHHHHHHHcCceeccccCCcccccccChhhhhhhccccCCCCcEEEEe
Q 008087 281 NDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKGVRIRRV 360 (578)
Q Consensus 281 n~~G~vVGI~~~~~~~~~~~~~~~aiPi~~i~~~l~~l~~~g~v~~~~~lGi~~~~~~~~~~~~~lgl~~~~~Gv~V~~V 360 (578)
|.+|+||||+++.+...+..+++||||++.+++++++|+++|++.+|||||+.++.+.++.+++.+||+. ..|++|..|
T Consensus 206 n~~GeVIGIntai~~~~~~~gigfAIP~~~v~~vl~~l~~~G~~~~r~~LGv~~~~~~~~~~~~~~~l~~-~~Gv~V~~V 284 (539)
T 4fln_A 206 NDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPALRECLKVPT-NEGVLVRRV 284 (539)
T ss_dssp CSSSCEEEEECCCC-----CCCEEEEEHHHHHHHHHHHHTTTSCCCCCBCCEEEEECCCHHHHHHHTCSS-SBCEEEEEE
T ss_pred cCCCcEEEEEEEEecCCCCCcceecccHHHHHHHHHHHHHcCeEEeeeecceEEEecCCHHHHHhcCCCC-cCceeeecc
Confidence 9999999999998766667899999999999999999999999877999999999987889999999986 579999999
Q ss_pred CCCCcccCCCCCCCEEEEECCEEeCCCCCCccccCcchhHHHHHhccCCCCEEEEEEEECCEEEEEEEEecccccccCCC
Q 008087 361 DPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKILNFNITLATHRRLIPSH 440 (578)
Q Consensus 361 ~p~spA~~GL~~GDiIl~InG~~V~~~~~v~~~~~~~~~~~~~~~~~~~g~~v~l~V~R~g~~~~~~v~l~~~~~~~~~~ 440 (578)
.++|||+++||+||+|++|||++|.+.+++.++..+++.|..++....+|++++|+|+|+|+++++++++...+...+.+
T Consensus 285 ~~~spA~~al~~GDvI~~idg~~V~~~g~~~~~~~~~~~l~~~v~~~~~Gd~v~l~v~R~Gk~~~v~Vtl~~~~~~~~~~ 364 (539)
T 4fln_A 285 EPTSDASKVLKEGDVIVSFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAGEHKKVQVVLRPRVHLVPYH 364 (539)
T ss_dssp CTTSGGGGTCCTTCEEEEETTEECBSSSEEECSTTCEEETHHHHHTSCTTCEEEEEEEETTEEEEEEEECBCCCCSSCSC
T ss_pred cCCChHHhCccCCCEEEEECCEEeCcCCeeccccchhHHHHHHHHcCCCCCEEEEEEEECCEEEEEEEEEccCccccccc
Confidence 99999988999999999999999999999888888888899999999999999999999999999999999998888888
Q ss_pred CCCCCCCceeeccEEEeeh-HHHHHHhchhhhhhhhhccccccccccccCCCceEEEEee----cCCcCCCCCCCEEEEe
Q 008087 441 NKGRPPSYYIIAGFVFSRC-LYLISVLSMERIMNMKLRSSFWTSSCIQCHNCQMSSLLWC----LRSPLCLNCFNKVLAF 515 (578)
Q Consensus 441 ~~~~~p~~~~~~Gl~~~~~-p~~~~~~g~~~~~~~~~l~~~~~~~~~~~~~~~~vvvs~v----~A~~aGl~~GD~I~~V 515 (578)
.....|+|++++||+|+++ +.+..+++.+. .+++++.... +.+.+...+++|+++++ ++..+|++.||+|++|
T Consensus 365 ~~~~~p~~~~~~Gl~f~~Lt~~~~~~~~~~~-~~~~l~~~~~-~~~~~~~~~~gVvvs~V~~~s~a~~~g~~~gdiI~~v 442 (539)
T 4fln_A 365 IDGGQPSYIIVAGLVFTPLSEPLIEEECEDT-IGLKLLTKAR-YSVARFRGEQIVILSQVLANEVNIGYEDMNNQQVLKF 442 (539)
T ss_dssp TTSSCCCCCCSTTEEEEECCHHHHTTSCSSS-SCHHHHHHHH-HCCCSSTTCCCEEEEEECCCGGGTTCSSCCSEEEEEE
T ss_pred cccCCCccccccceEEeeCCHHHHHhhcccc-cCceeeehhh-hhhhccCCceEEEEEEecCCchhhhcCCCCCCEEEeE
Confidence 8888999999999999999 66665555322 2333333322 34445566789999987 5777888999999999
Q ss_pred CCeecCCHHHHHHHHHhcCCCeEEEEEecCeEEEEechhhhHHHHHHHHHcCCCcCCCcCcCC
Q 008087 516 NGNPVKNLKSLANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDLKN 578 (578)
Q Consensus 516 NG~~V~~~~~l~~~l~~~~~~~v~l~v~R~~~~~l~~~~~~~~~~~i~~~~~i~~~~~~~~~~ 578 (578)
||++|+|++||.++|+++++++++|+++++..++|+++++++++++||++|+|||+||+||..
T Consensus 443 Ng~~V~s~~~l~~~l~~~k~~~l~~~~~~~~~ivL~~~~~~~~~~~Il~~~~I~~~~S~dl~~ 505 (539)
T 4fln_A 443 NGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASNSASLCILKDYGIPSERSADLLE 505 (539)
T ss_dssp TTEECCSHHHHHHHHHTCCSSEEEEEETTSCEEEEEHHHHHHHHHHHHTTTTCSCSSCGGGGS
T ss_pred CCEEcCCHHHHHHHHHHcCCCeEEEEECCCEEEEEEHHHHHHhHHHHHHhcCCCcccCcchhh
Confidence 999999999999999999999999999999999999999999999999999999999999963
|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 578 | ||||
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 4e-20 | |
| d1lcya2 | 205 | b.47.1.1 (A:6-210) Mitochondrial serine protease H | 1e-19 | |
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 2e-18 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 2e-18 | |
| d1agja_ | 242 | b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A | 2e-16 | |
| d2qf3a1 | 210 | b.47.1.1 (A:43-252) Stress sensor protease DegS, c | 5e-16 | |
| d1qtfa_ | 246 | b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus | 1e-15 | |
| d2qaaa1 | 185 | b.47.1.1 (A:16-242) Protease B {Streptomyces grise | 7e-15 | |
| d2bhga1 | 199 | b.47.1.4 (A:7-205) 3C cysteine protease (picornain | 2e-14 | |
| d2sgaa_ | 181 | b.47.1.1 (A:) Protease A {Streptomyces griseus, st | 7e-14 | |
| d2o8la1 | 216 | b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur | 1e-12 | |
| d2h5ca1 | 198 | b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac | 3e-11 | |
| d1lvmb_ | 219 | b.47.1.3 (B:) TEV protease (nucleat inclusion prot | 1e-09 | |
| d1hpga_ | 187 | b.47.1.1 (A:) Glutamic acid-specific protease {Str | 2e-08 | |
| d1sota1 | 99 | b.36.1.4 (A:255-353) Stress sensor protease DegS, | 1e-06 | |
| d1cqqa_ | 180 | b.47.1.4 (A:) 3C cysteine protease (picornain 3C) | 1e-06 | |
| d1p3ca_ | 215 | b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int | 2e-06 | |
| d2z9ia1 | 88 | b.36.1.4 (A:227-314) Protease PepD {Mycobacterium | 5e-06 | |
| d2i6va1 | 87 | b.36.1.5 (A:219-305) General secretion pathway pro | 6e-05 | |
| d1lcya1 | 100 | b.36.1.4 (A:226-325) Mitochondrial serine protease | 9e-05 | |
| d2hgaa1 | 103 | b.36.1.6 (A:23-125) Uncharacterized protein MTH136 | 3e-04 | |
| d1ky9b2 | 88 | b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t | 0.002 |
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Thermotoga maritima [TaxId: 2336]
Score = 87.3 bits (215), Expect = 4e-20
Identities = 56/227 (24%), Positives = 92/227 (40%), Gaps = 21/227 (9%)
Query: 110 DVEPGVARVV-PAMDAVVKVFCVHT---------------EPNFSLPWQRKRQYSSSSSG 153
D E + VV AVVK+ V T + LP +RQ +S SG
Sbjct: 1 DYESPIVNVVEACAPAVVKIDVVKTVKTSFFDPYFEQFFKKWFGELPPGFERQVASLGSG 60
Query: 154 FAIGGRRVLTNAHSVEHYTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVL 213
F + + V +KY A + E DIA++ ++ + +
Sbjct: 61 FIFDPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASD--KKFP 118
Query: 214 PVEFGELPALQ--DAVTVVGYPIGGD-TISVTSGVVSRIEILSYVHGSTELLGLQIDAAI 270
+EFG+ ++ + +G P+G T++V + I + +Q DAAI
Sbjct: 119 YLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAI 178
Query: 271 NSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQD 317
N GNSGGP N G+ +GI + ++ N+G+ IP + F+
Sbjct: 179 NPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDT 225
|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 | Back information, alignment and structure |
|---|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Length = 180 | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 578 | |||
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.98 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.97 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.96 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.96 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.95 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.82 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.8 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.78 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 99.68 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 99.66 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 99.63 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.62 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 99.58 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 99.57 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.56 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 99.53 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 99.48 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.42 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 99.38 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 99.27 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 99.23 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 99.21 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 99.16 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 99.15 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 99.14 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 99.13 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 99.12 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 99.1 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 99.1 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 99.08 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 99.07 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 99.07 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 99.07 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 99.06 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 99.04 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.04 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 99.04 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 99.04 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 99.03 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 99.03 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 99.02 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 99.01 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 98.99 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 98.99 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 98.99 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 98.97 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.97 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 98.96 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 98.96 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 98.95 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 98.95 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 98.95 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 98.93 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 98.93 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 98.93 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.92 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 98.92 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 98.91 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 98.91 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 98.91 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 98.91 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 98.9 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 98.89 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 98.86 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 98.86 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 98.84 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 98.83 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 98.83 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 98.82 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 98.82 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 98.81 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 98.8 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 98.77 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 98.77 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.76 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 98.73 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.73 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 98.63 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 98.58 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.57 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 98.51 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 98.51 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 98.49 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.47 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 98.47 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 98.46 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 98.43 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.41 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 98.37 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 98.32 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 98.29 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.28 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 98.27 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 98.23 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 98.21 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 98.2 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 98.19 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 98.19 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.19 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 98.18 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.18 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.17 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.14 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 98.14 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.13 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.13 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 98.13 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 98.13 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 98.09 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.07 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.06 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.06 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.05 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 98.05 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 98.05 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.03 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 98.03 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 98.03 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 98.02 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 98.01 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 98.01 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 98.0 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 98.0 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.99 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.99 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 97.94 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 97.94 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 97.92 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 97.91 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 97.91 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.91 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 97.89 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 97.89 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.89 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 97.89 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 97.87 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 97.85 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.83 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 97.83 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 97.81 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 97.79 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 97.78 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 97.77 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 97.77 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 97.77 | |
| d1mbma_ | 198 | NSP4 proteinase {Equine arteritis virus, EAV [TaxI | 97.76 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 97.75 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 97.71 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 97.71 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 97.7 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 97.68 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 97.63 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 97.62 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 97.6 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 97.6 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 97.59 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.59 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 97.55 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 97.54 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 97.54 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.53 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 97.53 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 97.52 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 97.52 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 97.51 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 97.51 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 97.5 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 97.5 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.49 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 97.47 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.46 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.46 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 97.45 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 97.43 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 97.42 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.42 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 97.42 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 97.4 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 97.39 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 97.38 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.37 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 97.36 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 97.33 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 97.32 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 97.31 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 97.29 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.29 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 97.29 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.28 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 97.27 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 97.25 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 97.22 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 97.2 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.19 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 97.15 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 97.15 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.14 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 97.14 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 97.09 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 97.06 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.06 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 96.92 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 96.9 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 96.9 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 96.89 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 96.86 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 96.86 | |
| d2h6ma1 | 212 | 3C cysteine protease (picornain 3C) {Human hepatit | 96.38 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 96.34 | |
| d2fp7b1 | 152 | NS3 protease {West nile virus [TaxId: 11082]} | 92.44 | |
| d2fomb1 | 150 | NS3 protease {Dengue virus type 2 [TaxId: 11060]} | 92.22 | |
| d1ep5a_ | 156 | Viral capsid protein {Venezuelan equine encephalit | 88.37 | |
| d1wyka_ | 152 | Viral capsid protein {Sindbis virus [TaxId: 11034] | 88.2 | |
| d1vcpa_ | 149 | Viral capsid protein {Semliki forest virus [TaxId: | 86.22 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=99.98 E-value=1.6e-32 Score=271.15 Aligned_cols=170 Identities=26% Similarity=0.411 Sum_probs=145.5
Q ss_pred ceEEEEEEEc-C-CEEEecccccCCCceEEEEEcCCCcEEEEEEEEEcCCCCEEEEEEeeCCCCCCeeeEEcCCC--CCC
Q 008087 148 SSSSSGFAIG-G-RRVLTNAHSVEHYTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGEL--PAL 223 (578)
Q Consensus 148 ~~~GsGfvI~-~-g~ILT~aHvV~~~~~i~V~~~~~g~~~~a~vv~~d~~~DlAlLkv~~~~~~~~~~~l~l~~~--~~~ 223 (578)
.+.||||+|+ + ||||||+|||.++..+.|++ .+++.+.|+++..|+.+|+|+|+++... .+++++|+++ .++
T Consensus 75 ~~~GSG~iI~~~~g~IlTn~HVv~~~~~~~v~~-~~~~~~~a~~~~~d~~~dlavl~i~~~~---~~~~~~l~~~~~~~~ 150 (249)
T d1ky9a2 75 MALGSGVIIDADKGYVVTNNHVVDNATVIKVQL-SDGRKFDAKMVGKDPRSDIALIQIQNPK---NLTAIKMADSDALRV 150 (249)
T ss_dssp EEEEEEEEEETTTTEEEEEHHHHTTEEEEEEEE-TTSCEEEEEEEEEETTTTEEEEEESSCC---SCCCCCBCCGGGCCT
T ss_pred cccccEEEEeccCceEEeeccccccceeeeeee-cccccccceeeEeccchhhceeeecccc---cceEEEcCCcCcCCc
Confidence 4689999996 4 89999999999999999999 5999999999999999999999998764 6888999874 467
Q ss_pred CCcEEEEeecCCCCcceEEEeEEeceeeeeecCCceeeeEEEEecCCCCCCccceEEccCCeEEEEEecccccc-ccCCc
Q 008087 224 QDAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHE-DVENI 302 (578)
Q Consensus 224 g~~V~~iG~p~g~~~~sv~~G~Is~~~~~~~~~~~~~~~~i~~da~i~~G~SGGPlvn~~G~vVGI~~~~~~~~-~~~~~ 302 (578)
|++|+++|||++... +++.|+++...+.... ......+||+|+++++|||||||||.+|+||||+++.+... +..++
T Consensus 151 G~~v~aiG~P~g~~~-tvt~~~~~~~~~~~~~-~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi 228 (249)
T d1ky9a2 151 GDYTVAIGNPFGLGE-TVTSGIVSALGRSGLN-AENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGI 228 (249)
T ss_dssp TCEEEEEECTTSSSC-EEEEEEEEEESSCC------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSS
T ss_pred CCEEEEEecccccCC-ceeecceeeccccccc-CccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccE
Confidence 999999999999776 8999999887654322 22233579999999999999999999999999999977543 34689
Q ss_pred eeeecchhHHHHHHHHHHcCc
Q 008087 303 GYVIPTPVIMHFIQDYEKNGA 323 (578)
Q Consensus 303 ~~aiPi~~i~~~l~~l~~~g~ 323 (578)
+||||++.+++++++|+++|+
T Consensus 229 ~faIP~~~~~~~~~~l~~~G~ 249 (249)
T d1ky9a2 229 GFAIPSNMVKNLTSQMVEYGQ 249 (249)
T ss_dssp EEEEEHHHHHHHHHHHHHHSS
T ss_pred EEEEEHHHHHHHHHHHHHhCc
Confidence 999999999999999998764
|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} | Back information, alignment and structure |
|---|
| >d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} | Back information, alignment and structure |
|---|
| >d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} | Back information, alignment and structure |
|---|
| >d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} | Back information, alignment and structure |
|---|