Citrus Sinensis ID: 008153


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570------
MKRDHQHSYGGGSGSGKGDYSSSTGNANKAKMWEEEQDTGGMDELLEVLGYKVRSSEMADVAQKLEQLEMVMGTAQEDGISHLATDTVHYNPSDVSGWVQSMLEGLNNTGFDSQARPIQDPAESSTVNSILGQQTSNQSRIFNDDSEYDLRAIPGSAAYPQPDSETENNRNKRMRVEINTANTNTIIPTELARPVVVDSQETGVQLVHTLMACAEAIQQENLKVADALVKHIGLLAAAQAGAMRKVATYFAEALARRIYRIYPQDCLDSSYNDILQMHFYETCPYLKFAHFTANQAILEAFNNANRVHVIDFSLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLADTIGVEFEFRGFVCNSLADLEPDMLDIRPPEVETVAVNSVFELHRLLARPGGIEKVVSSIKAMRPKIITIVEQEANHNSPVFLDRFTEALHYYSSLFDSLEGSGLTPPSQDQVMSEVYLGRQICNIVACDGTDRNERHETLTQWRTRLGSAGFEPVHLGSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAKSTLVS
ccccccccccccccccccccccccccccccccHHHHHccccccHHHHHcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHcHHcccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHccccHHHHHHHcccccEEEEEcccccccccHHHHHHHHccccccccEEEEECcccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccEEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccEEEEECccEEEEECcccEEEEEEccccccccccc
********************************************LLEVLGYKVRSSEMADVAQKLE***MVMG****DGISHLATDTVHYNPSDVSGWVQSMLE****************************************************************************************RPVVVDSQETGVQLVHTLMACAEAIQQENLKVADALVKHIGLLAAAQAGAMRKVATYFAEALARRIYRIYPQDCLDSSYNDILQMHFYETCPYLKFAHFTANQAILEAFNNANRVHVIDFSLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLADTIGVEFEFRGFVCNSLADLEPDMLDIRPPEVETVAVNSVFELHRLLARPGGIEKVVSSIKAMRPKIITIVEQEANHNSPVFLDRFTEALHYYSSLFDSLEGSGLTPPSQDQVMSEVYLGRQICNIVACDGTDRNERHETLTQWRTRLGSAGFEPVHLGSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAKSTL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRDHQHSYGGGSGSGKGDYSSSTGNANKAKMWEEEQDTGGMDELLEVLGYKVRSSExxxxxxxxxxxxxxxxxxxxxGISHLATDTVHYNPSDVSGWVQSMLEGLNNTGFDSQARPIQDPAESSTVNSILGQQTSNQSRIFNDDSEYDLRAIPGSAAYPQPDSETENNRNKRMRVEINTANTNTIIPTELARPVVVDSQETGVQLVHTLMACAEAIQQENLKVADALVKHIGLLAAAQAGAMRKVATYFAEALARRIYRIYPQDCLDSSYNDILQMHFYETCPYLKFAHFTANQAILEAFNNANRVHVIDFSLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLADTIGVEFEFRGFVCNSLADLEPDMLDIRPPEVETVAVNSVFELHRLLARPGGIEKVVSSIKAMRPKIITIVEQEANHNSPVFLDRFTEALHYYSSLFDSLEGSGLTPPSQDQVMSEVYLGRQICNIVACDGTDRNERHETLTQWRTRLGSAGFEPVHLGSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAKSTLVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DELLA protein GAI Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.probableQ84TQ7
DELLA protein GAI Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. In contrast to RGA, it is less sensitive to GA. Its activity is probably regulated by other phytohormones such as auxin and ethylene.probableQ9LQT8
DELLA protein GAI Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination.probableQ7Y1B6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZSH, chain B
Confidence level:very confident
Coverage over the Query: 41-106
View the alignment between query and template
View the model in PyMOL
Template: 3DTN, chain A
Confidence level:probable
Coverage over the Query: 295-475,486-522
View the alignment between query and template
View the model in PyMOL
Template: 4GEK, chain A
Confidence level:probable
Coverage over the Query: 306-522
View the alignment between query and template
View the model in PyMOL
Template: 3GIW, chain A
Confidence level:probable
Coverage over the Query: 280-434
View the alignment between query and template
View the model in PyMOL