Citrus Sinensis ID: 008156

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570------
MKCEGATSVRALVLQSLKNGFLPHMKWVSASGLLGILGVAGFVLALKKDAKIGNLSGFSWLSEKENRLEKLCLVPGLQNLGNNCFLNVILQALASCTCFLPFLQKVMGECEEPDEDLPLTVALASLLEELCLVGETRLVLSPQKVMLAMELYIQNFNLTSQQDAEEAFLHLMSSLREEFLESYSPNESSLVDAFEAASCRILSLKRREVQSEQKRWRKHFFGPFDGILGSILTCQSCLSQISLDYQFFHSLPLSPVLDSGSTIPFGCTLEDCLKQFLTAEQLENYHCSHCWHIAAIKYLSITEANEMEIEELRRCSAQDSCNCRSRLHLETLPWSNKFSHTLKKLSISHCPQILCIHLQRVSINEMGELVKIWGHIAFPLILDLFPFVKSGVGINDLDESWQRGQAKVLNERPSSSLNHVNRKYDAKVLNSIYGLTGKNNHTKALGVDELGCTAHEKEFRGESILPPTQSGSNVRGRDIQMQPDDEVIGSSQLCQPNTYLYRLASVVEHFGRVGSGHYTVYRSVRVESHEENPNEHFETPLTHWFCISDSQVYSVSVNDVLAAEASLLFYERIIES
ccccccccEEEEEEEcccccccccccccccccccccccccccEEcccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccCECcHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccEEccccccccccHHHHHcccEEccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEEEEcccEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEECcccccccEEEEEEccccccccccccccccccccEEEEEcccCEEcccccccccccEEEEEEEEccc
********VRALVLQSLKNGFLPHMKWVSASGLLGILGVAGFVLALKKDAKIGNLSGFSWLSEKENRLEKLCLVPGLQNLGNNCFLNVILQALASCTCFLPFLQKVMGECEEPDEDLPLTVALASLLEELCLVGETRLVLSPQKVMLAMELYIQNFNLTSQQDAEEAFLHLMSSLREEFL*************FEAASCRILSLKRREVQSEQKRWRKHFFGPFDGILGSILTCQSCLSQISLDYQFFHSLPLSPVLDSGSTIPFGCTLEDCLKQFLTAEQLENYHCSHCWHIAAIKYLSITEANEMEIEELRRCSAQDSCNCRSRLHLETLPWSNKFSHTLKKLSISHCPQILCIHLQRVSINEMGELVKIWGHIAFPLILDLFPFVKSGVGINDL**********************VNRKYDAKVLNSIYGLTGKNNHTKALGVDELGCTAHEKEFRGESILPPTQSGSNVRGRDIQMQPDDEVIGSSQLCQPNTYLYRLASVVEHFGRVGSGHYTVYRSVRV*************PLTHWFCISDSQVYSVSVNDVLAAEASLLFYERIIE*
xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCEGATSVRALVLQSLKNGFLPHMKWVSASGLLGILGVAGFVLALKKDAKIGNLSGFSWLSEKENRLEKLCLVPGLQNLGNNCFLNVILQALASCTCFLPFLQKVMGECEEPDEDLPLTVALASLLEELCLVGETRLVLSPQKVMLAMELYIQNFNLTSQQDAEEAFLHLMSSLREEFLESYSPNESSLVDAFEAASCRILSLKRREVQSEQKRWRKHFFGPFDGILGSILTCQSCLSQISLDYQFFHSLPLSPVLDSGSTIPFGCTLEDCLKQFLTAEQLENYHCSHCWHIAAIKYLSITEANEMEIEELRRCSAQDSCNCRSRLHLETLPWSNKFSHTLKKLSISHCPQILCIHLQRVSINEMGELVKIWGHIAFPLILDLFPFVKSGVGINDLDESWQRGQAKVLNERPSSSLNHVNRKYDAKVLNSIYGLTGKNNHTKALGVDELGCTAHEKEFRGESILPPTQSGSNVRGRDIQMQPDDEVIGSSQLCQPNTYLYRLASVVEHFGRVGSGHYTVYRSVRVESHEENPNEHFETPLTHWFCISDSQVYSVSVNDVLAAEASLLFYERIIES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 85-293,339-392,496-525,540-575
View the alignment between query and template
View the model in PyMOL
Template: 2AYN, chain A
Confidence level:very confident
Coverage over the Query: 71-186,218-293,339-414,476-524,540-573
View the alignment between query and template
View the model in PyMOL
Template: 1VJV, chain A
Confidence level:very confident
Coverage over the Query: 70-181,218-281,292-293,339-405,416-438,450-466,483-525,539-574
View the alignment between query and template
View the model in PyMOL
Template: 4FIP, chain A
Confidence level:probable
Coverage over the Query: 21-135,146-204,224-314
View the alignment between query and template
View the model in PyMOL
Template: 3SHQ, chain A
Confidence level:probable
Coverage over the Query: 2-63
View the alignment between query and template
View the model in PyMOL