Citrus Sinensis ID: 008159

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-----

MLLLFCRWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRYHIWLGTAMIFFATIHGGSTLFVWGVSHHIQDEMWRWQKTGRIYLAGEIALVTGLVMWITSLPQIRRKKFEFFYYTHHLYIIFLIFFLFHAGDRHFYMVFGGIFLFGLDKLLRFIQSRPETCILSARVFPSKAIELILPKHAGLKFTPTSVIFMKIPSISKFQWHSFSITSSSSVDDQTMSLIVKCDGEWTSSLYQMIHAELDSDADQMRCIPVAIEGPYGPATMDFLRYDSLLLVAGGIGITPFLSILQEIASAQSNRKYRFPSKVQLIYVIKSSQEICLLNSISPLLSNQQSKKWHLTLKVFVTQEEQSSVTVREVLNDLSLVRAVRFGTQSNYAVNGLESLIWMAALVGITSILFVIFLISLNHIFVPVEKKLPSEKLAAPSEKVVSKEKTPSWVADLIILSSFIIAITGSTLMAILLRWRRLKKQTPPVSLNQGKAVQVLGPIEEEHEINFGGRPNFEEIFSELEKETAGSDIGVLVCGPESMKESVAKTSQRKSQCFMMNANKDKPYFNFHSLNFTF

cEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEcccccccccccEEEEEcccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHccccccccccCEEEEEEccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHcccccccccCEEEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEEEEccccccHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcEEECcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccCEEECcccccHHHHHHHHHHHccccCEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccCEEEEccccc

MLLLFCRWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRYHIWLGTAMIFFATIHGGSTLFVWGVSHHIQDEMWRWQKTGRIYLAGEIALVTGLVMWITSLPQIRRKKFEFFYYTHHLYIIFLIFFLFHAGDRHFYMVFGGIFLFGLDKLLRFIQSRPETCILSARVFPSKAIELILPKHAGLKFTPTSVIFMKIPSISKFQWHSFSITSSSSVDDQTMSLIVKCDGEWTSSLYQMIHAELDSDADQMRCIPVAIEGPYGPATMDFLRYDSLLLVAGGIGITPFLSILQEIASAQSNRKYRFPSKVQLIYVIKSSQEICLLNSISPLLSNQQSKKWHLTLKVFVTQEEQSSVTVREVLNDLSLVRAVRFGTQSNYAVNGLESLIWMAALVGITSILFVIFLISLNHIFVPVEKKLPSEKLAAPSEKVVSKEKTPSWVADLIILSSFIIAITGSTLMAILLRWRRLKKQ************QVLGPIEEEHEINFGGRPNFEEIFSELEKETAGSDIGVLVCGPESMKESVAKTSQRKSQ*****ANKDKPYFNFHSLNFTF

xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ferric reduction oxidase 8, mitochondrial	Ferric chelate reductase probably involved in iron reduction in leaf veins for transport. May participate in the transport of electrons to a Fe(3+) ion via FAD and heme intermediates.	probable	Q8VY13

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A1F, chain A
Confidence level:very confident
Coverage over the Query: 267-361,501-573
View the alignment between query and template
View the model in PyMOL

Template: 2PIA, chain A
Confidence level:very confident
Coverage over the Query: 173-252,263-493
View the alignment between query and template
View the model in PyMOL