Citrus Sinensis ID: 008170

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-----
MSKSFNIIKTNTSNPKVWVVIGVSVVGFVVLAETLRRRRNPKLNGRVDFGAFLERFELIPFPQPPPPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEAERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVAVAAQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAVEPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHMNVGQYIASNVPSLKGLRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRLGYNVFERVLEAINTTQDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKTYSAEFHDRTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDSLQEQVNIASNLVPLPDTNGSIDASELLKEKGNAAFKGKQWNKAVNYYSEAIKLNGTSATYYSNRAAAYLELGCFQQAEEDCSKTISLDKKVRARVGYVDCSMLIYLLCIV
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccccccccccccccccccccEEEEEEcccccccccccccHHHccccccccccHHHHHHHHHcccEEcccHHccccccccccccccccccccccccccccccccHHHHHHHHcccccEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccEEECcccccccccccccccccHHHHHHHccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc
******IIKTNTSNPKVWVVIGVSVVGFVVLAETLRRRRNPKLNGRVDFGAFLERFELIPF**********PLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEAERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSS***AVAVAAQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAVEPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHMNVGQYIASNVPSLKGLRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRLGYNVFERVLEAINTTQDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKTYSAEFHDRTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDSLQEQVNIASNLVPLPD*********LLKEKGNAAFKGKQWNKAVNYYSEAIKLNGTSATYYSNRAAAYLELGCFQQAEEDCSKTISLDKKVRARVGYVDCSMLIYLLCIV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKSFNIIKTNTSNPKVWVVIGVSVVGFVVLAETLRRRRNPKLNGRVDFGAFLERFELIPFPQPPPPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEAERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVAVAAQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAVEPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHMNVGQYIASNVPSLKGLRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRLGYNVFERVLEAINTTQDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKTYSAEFHDRTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDSLQEQVNIASNLVPLPDTNGSIDASELLKEKGNAAFKGKQWNKAVNYYSEAIKLNGTSATYYSNRAAAYLELGCFQQAEEDCSKTISLDKKVRARVGYVDCSMLIYLLCIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Outer envelope protein 64, mitochondrial Chaperone receptor mediating Hsp90-dependent protein targeting to mitochondria.probableF4KCL7
Translocon at the outer membrane of chloroplasts 64 Chaperone receptor mediating Hsp90-dependent protein targeting to chloroplasts. Bi-functional preprotein receptor acting on both sides of the membrane.probableQ9MUK5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 486-574
View the alignment between query and template
View the model in PyMOL
Template: 3H0L, chain A
Confidence level:very confident
Coverage over the Query: 21-466
View the alignment between query and template
View the model in PyMOL
Template: 3PPM, chain A
Confidence level:very confident
Coverage over the Query: 9-469
View the alignment between query and template
View the model in PyMOL
Template: 3AL0, chain A
Confidence level:probable
Coverage over the Query: 75-484
View the alignment between query and template
View the model in PyMOL