Citrus Sinensis ID: 008178


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-----
MEISTEAKLEPFLQWLQVNKVELRGCKIKYSDESKGFGIFSSNEFSDGVLLVVPLDLAITPMRVLQDPLIGPECRAMFEDGEVDDRFLMILFLTVERLRKNSSWKPYLDMLPTTFGNPLWFTDDELLELKGTTLYRATELQKQNLLTLYDDKVKDLVKKLLVLDGDSESEVSFEDFLWANSIFWTRALNIPLPHSYVFPQNQEDLNKYDSINNSAELSNDHNSRGELINGLNDIKNEAQRVNSQVNGATSTLTSTQGETLWIEGLVPGIDFCNHDLKAAATWEVDGTGLITGVPFSMYLLSVERSSFHSEKEISISYGNKGNEELLYLYGFVIDNNPDDYLMIHYPAEAIHSIPLSDSKALLLEEQKAQLRCLLPKSLLEHGFFAAGHPKDGNNDNKLEVDRISSFSWSGQRRMPSYLNKLVFPENFLTALRTIAMQEDEISKVSSLLEELVGSGGERQPSDAEVRAAVWETCGDSGALQLLVDLLQAKLTELEESSGTEDYDSELLLKSCITESQGQHASCENNSSEETNGWTQHKMSRKTWSSIVYRRGQKELALLFLKEAEHALQLALTEGN
ccccccccHHHHHHHHHHcccEEcccEEEEcccccCEEEEEccccccccEEEccccccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccEEEEEcccccccccEEEccccccccHHHHHHcccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccc
*****EA*LEPFLQWLQVNKVELRGCKIKYSDESKGFGIFSSNEFSDGVLLVVPLDLAITPMRVLQDPLIGPECRAMFEDGEVDDRFLMILFLTVERLRKNSSWKPYLDMLPTTFGNPLWFTDDELLELKGTTLYRATELQKQNLLTLYDDKVKDLVKKLLVLDGDSESEVSFEDFLWANSIFWTRALNIPLPHSYVFPQNQEDLNKYDSINNSAELSNDHNSRGELINGLNDIKNEAQRVNSQVNGATSTLTSTQGETLWIEGLVPGIDFCNHDLKAAATWEVDGTGLITGVPFSMYLLSVERSSFHSEKEISISYGNKGNEELLYLYGFVIDNNPDDYLMIHYPAEAIHSIPLSDSKALLLEEQKAQLRCLLPKSLLEHGFFAAG************************RRMPSYLNKLVFPENFLTALRTIAMQEDEISKVS*******************VRAAVWETCGDSGALQLLVDLLQAKLT*************************************************KTWSSIVYRRGQKELALLFLKEAEHALQLAL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEISTEAKLEPFLQWLQVNKVELRGCKIKYSDESKGFGIFSSNEFSDGVLLVVPLDLAITPMRVLQDPLIGPECRAMFEDGEVDDRFLMILFLTVERLRKNSSWKPYLDMLPTTFGNPLWFTDDELLELKGTTLYRATELQKQNLLTLYDDKVKDLVKKLLVLDGDSESEVSFEDFLWANSIFWTRALNIPLPHSYVFPQNQEDLNKYDSINNSAELSNDHNSRGELINGxxxxxxxxxxxxxxxxxxxxxLTSTQGETLWIEGLVPGIDFCNHDLKAAATWEVDGTGLITGVPFSMYLLSVERSSFHSEKEISISYGNKGNEELLYLYGFVIDNNPDDYLMIHYPAEAIHSIPLSDSKALLLEEQKAQLRCLLPKSLLEHGFFAAGHPKDGNNDNKLEVDRISSFSWSGQRRMPSYLNKLVFPENFLTALRTIAMQEDEISKVSSLLEELVGSGGERQPSDAEVRAAVWETCGDSGALQLLVDLLQAKLTELEESSGTEDYDSELLLKSCITESQGQHASCENNSSEETNGWTQHKMSRKTWSSIVYRRGQKELALLFLKEAEHALQLALTEGN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H21, chain A
Confidence level:very confident
Coverage over the Query: 6-191,262-284,297-369,380-385,406-407,418-510,537-568
View the alignment between query and template
View the model in PyMOL
Template: 3SMT, chain A
Confidence level:very confident
Coverage over the Query: 4-195,258-371,382-384,407-510,537-567
View the alignment between query and template
View the model in PyMOL
Template: 3QXY, chain A
Confidence level:very confident
Coverage over the Query: 6-202,215-216,246,257-287,298-388,406-409,420-512,535-562
View the alignment between query and template
View the model in PyMOL
Template: 1MLV, chain A
Confidence level:probable
Coverage over the Query: 9-223
View the alignment between query and template
View the model in PyMOL