Citrus Sinensis ID: 008181


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-----
MYRIASKLASSISSPAAKKGVYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSIGNPKVTKDGVTVARSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGVNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELEVVGGMKLARGYISPYFVTDPKTQKCELENPLILIYDKKISDMNSLVGLLELAVEKNRALLIVAEDVERDALAMLILNKHHAGVKVCAIKAPGFGDNRRANLDDLAILTGGEIISEDRGLTLDKVKEEMLGTAKKVTVSVDDTIVLHGGGDKKLIEERCEEVCQTAMGKSAATFDREKAQERLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALENLKTENEDQRRGIHIIQNALKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAAKGEYVDMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLVNSDDKNKPPSRVPNMDGLGY
cccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHEEEEcccccHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEccccccccccccccccccccEEEccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccCEEEEEEcccccHHHHHHHHHHHHHHccCEEEcccccccccccccccccccEEEEEcccEEEEcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEECccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc
********************VYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSIGNPKVTKDGVTVARSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGVNVMDLRSGIKMAIDAVISDLKSRAQMIS**EEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELEVVGGMKLARGYISPYFVTDPKTQKCELENPLILIYDKKISDMNSLVGLLELAVEKNRALLIVAEDVERDALAMLILNKHHAGVKVCAIKAPGFGDNRRANLDDLAILTGGEIISEDRGLTLDKVKEEMLGTAKKVTVSVDDTIVLHGGGDKKLIEERCEEVCQTAMGKSAATFDREKAQERLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALENLKTENEDQRRGIHIIQNALKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAAKGEYVDMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLV********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRIASKLASSISSPAAKKGVYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSIGNPKVTKDGVTVARSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGVNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELEVVGGMKLARGYISPYFVTDPKTQKCELENPLILIYDKKISDMNSLVGLLELAVEKNRALLIVAEDVERDALAMLILNKHHAGVKVCAIKAPGFGDNRRANLDDLAILTGGEIISEDRGLTLDKVKEEMLGTAKKVTVSVDDTIVLHGGGDKKLIEERCEEVCQTAMGKSAATFDREKAQERLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKAxxxxxxxxxxxxxxxxxxxxxLKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAAKGEYVDMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLVNSDDKNKPPSRVPNMDGLGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chaperonin CPN60-like 2, mitochondrial Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.confidentQ93ZM7
60 kDa chaperonin Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions.probableB0BUM0
60 kDa chaperonin 1 Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions.probableA4YRI5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WE3, chain A
Confidence level:very confident
Coverage over the Query: 33-549
View the alignment between query and template
View the model in PyMOL