Citrus Sinensis ID: 008214


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570---
MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYPSWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITWPVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKVKDVWLKLVKDLDVQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGEKALKSGANGTEAIELEKDASQKRREVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKSETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFELDGTKSGKLKLHLKWMPQPIYRDT
cccccHHHHHHHHHHHHHEEEEEEcccHHHHHHHHHHHHHHHHHHcHHHHccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccEEEEEEEEEcccccEEEEccccccccEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEccccccccEEEEEEEEcccccEEEEEEEEccccccccccccHHHHHHHHHHHcccccccEEEccccccccccccccccEEEEEEEEEccccccccccccccccEEEEEccccccccccEEccccccccccEEEEEEEEEccccEEEEEEEEccccccccEEEEEEEEccccccccEEEEEEEcccccccccccEEEEEEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHcccccccccEEEEEEEEEEEEEcccccccccccccEEEEEEccEEEEEEEEEEccccccEEccEEEEEEEEccccEEEEEEEEccccccccEEEEEEEccHHcccccccEEEEccccccEEEEEEEEEEEEEccccc
cccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHcccccccccEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccEEEEEEEEEccccEEEEEEEEEEcccccEEEEEEEEEEcEccEEEEEEEEEEEEEEEEEccccccccEEEEEEEEcccccEEEEEEEccccHHccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccEEEEEEEEEEEccccccccccccEEEEEEEEccccccEEccccccccccEEEEEEEEccEcccccEEEEEEEEccccccccccEEEEEEHHHccccccccEEEEccccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccccccHccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccEEEEEEcccEEEEEcEEEEccccccccEEEEEEEccccccEEEEEEEEcccccccccEEEEEEHHHHHHcccccEEEEcccccccEEEEEEEEEEccccccc
MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVedskkilpaefypswvvfSHRQKLTWLNHHLEKLWPYVNEAASELIKSsvepvleqyRPFILSslkfskftlgtvapqftgvsiiedggsgvtMELEMQWDANSSIILAIKTRLGValpvqvknigftGVFRLIfrplvdefpgfaaVSYSLREKKKLDFKLKVvggdistipglsdsIEATIHDAIedsitwpvrkivpilpgdyselelkpvgtLEVKLVQAkgltnkdligksdpyavlfvrplpektkksktinndlnpiwNEHFEFIVEDESTQHLVVRIyddegiqsseliGCAQVRlcelepgkvKDVWLKLVKDldvqrdtkyrgQVHLELLycpfgmenvftnpfapnfsmTSLEKVLTNGEKALKSGANGTEAIELEKDASQKRREVIIRGVLSVTVILAenlpasdlmgkadpYVVLTMKksetrnktrvVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWdhdtfgkdymgrCILTLTRVILegeytdcfeldgtksgklklhlkwmpqpiyrdt
MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYPSWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGdistipglsdsIEATIHDAiedsitwpvRKIVPILPGDYSELELKPVGTLEVKLVQAKgltnkdligksdpyAVLFVrplpektkksktinndlnPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCElepgkvkdVWLKLVKDldvqrdtkyrGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGEKAlksgangteaielekdasqkRREVIIRGVLSVTVILAenlpasdlmgkaDPYVVLTMkksetrnktrvvndclnpIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFEldgtksgklklhlkwmpqpiyrdt
MgfffglvvglvvglgiivgfvRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYPSWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITWPVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGkvkdvwlklvkdldvQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGEKALKSGANGTEAIELEKDASQKRREVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKSETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFELDGTKSGKLKLHLKWMPQPIYRDT
**FFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYPSWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITWPVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLP******KTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKVKDVWLKLVKDLDVQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKV*****************************EVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKSETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFELDGTKSGKLKLHLKWMP*******
MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYPSWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITWPVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLT*****GKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKVKDVWLKLVKDL*****TKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGE*************************VIIRGVLSVTVILA*************PYVVLTMKKSETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFELDGTKSGKLKLHLKWMPQPIYR**
MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYPSWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITWPVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKVKDVWLKLVKDLDVQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGEKALKSGANGTEAIELEKDASQKRREVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKSETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFELDGTKSGKLKLHLKWMPQPIYRDT
MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYPSWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITWPVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKVKDVWLKLVKDLDVQRDTKYRGQVHLELLYCPFGM***************************************************IIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKSETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFELDGTKSGKLKLHLKWMPQPI****
iHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYPSWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITWPVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKVKDVWLKLVKDLDVQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGEKALKSGANGTEAIELEKDASQKRREVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKSETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFELDGTKSGKLKLHLKWMPQPIYRDT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query573 2.2.26 [Sep-21-2011]
Q8L706560 Synaptotagmin-5 OS=Arabid yes no 0.977 1.0 0.748 0.0
A0JJX5569 Synaptotagmin-4 OS=Arabid no no 0.987 0.994 0.700 0.0
Q9SKR2541 Synaptotagmin-1 OS=Arabid no no 0.895 0.948 0.310 9e-63
B6ETT4537 Synaptotagmin-2 OS=Arabid no no 0.897 0.957 0.291 2e-59
Q7XA06540 Synaptotagmin-3 OS=Arabid no no 0.898 0.953 0.274 6e-58
Q5DTI8 891 Extended synaptotagmin-3 yes no 0.837 0.538 0.264 8e-32
Q5RAG2 1104 Extended synaptotagmin-1 yes no 0.881 0.457 0.254 2e-31
Q7ZWU7 876 Extended synaptotagmin-2- N/A no 0.816 0.534 0.256 2e-31
Q9Z1X1 1088 Extended synaptotagmin-1 no no 0.883 0.465 0.246 3e-31
Q5FWL4 872 Extended synaptotagmin-2- N/A no 0.780 0.512 0.255 6e-31
>sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 Back     alignment and function desciption
 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/573 (74%), Positives = 500/573 (87%), Gaps = 13/573 (2%)

Query: 1   MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYP 60
           MGF  G+V+GL+VG+ II+GFV+ EN+RSKLRSELA T+AAFARMTVEDS+K+LP EFYP
Sbjct: 1   MGFIVGVVIGLLVGIAIIIGFVKLENSRSKLRSELANTVAAFARMTVEDSRKLLPPEFYP 60

Query: 61  SWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLG 120
           SWVVFS RQKLTWLNHHL K+WPYV+EAASELIK+SVEPVLEQYRP I++SL FSK TLG
Sbjct: 61  SWVVFSERQKLTWLNHHLTKIWPYVDEAASELIKASVEPVLEQYRPAIVASLTFSKLTLG 120

Query: 121 TVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRL 180
           TVAPQFTGVS+I+   +G+T+EL+MQWD N +I+L +KT +GV+LP+QVKNIGFTGVFRL
Sbjct: 121 TVAPQFTGVSVIDGDKNGITLELDMQWDGNPNIVLGVKTLVGVSLPIQVKNIGFTGVFRL 180

Query: 181 IFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITW 240
           IFRPLV++FP F AVS SLREKKKLDF LKVVGGDIS IPGLS++IE TI DA+EDSITW
Sbjct: 181 IFRPLVEDFPCFGAVSVSLREKKKLDFTLKVVGGDISAIPGLSEAIEETIRDAVEDSITW 240

Query: 241 PVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKK 300
           PVRK++PI+PGDYS+LELKPVG LEVKLVQAK LTNKDL+GKSDP+A +F+RPL EKTK+
Sbjct: 241 PVRKVIPIIPGDYSDLELKPVGMLEVKLVQAKNLTNKDLVGKSDPFAKMFIRPLREKTKR 300

Query: 301 SKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKVK 360
           SKTINNDLNPIWNEHFEF+VED STQHLVVRIYDDEG+Q+SELIGCAQ+RLCELEPGKVK
Sbjct: 301 SKTINNDLNPIWNEHFEFVVEDASTQHLVVRIYDDEGVQASELIGCAQIRLCELEPGKVK 360

Query: 361 DVWLKLVKDLDVQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGEKA 420
           DVWLKLVKDL++QRDTK RG+VHLELLY P+G  N   NPF  + SMTSLE+VL N    
Sbjct: 361 DVWLKLVKDLEIQRDTKNRGEVHLELLYIPYGSGNGIVNPFVTS-SMTSLERVLKN---- 415

Query: 421 LKSGANGTEAIELEKDASQKRREVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKS 480
                   +  + E  +S+KR++VI+RGVLSVTVI AE +P  DLMGKADPYVVL+MKKS
Sbjct: 416 --------DTTDEENASSRKRKDVIVRGVLSVTVISAEEIPIQDLMGKADPYVVLSMKKS 467

Query: 481 ETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVIL 540
             ++KTRVVND LNP+WNQTFDFVVEDGLHDML+ EVWDHDTFGKDY+GRCILTLTRVI+
Sbjct: 468 GAKSKTRVVNDSLNPVWNQTFDFVVEDGLHDMLVLEVWDHDTFGKDYIGRCILTLTRVIM 527

Query: 541 EGEYTDCFELDGTKSGKLKLHLKWMPQPIYRDT 573
           E EY D + LD +K+GKL+LHLKWM Q IYRD+
Sbjct: 528 EEEYKDWYPLDESKTGKLQLHLKWMAQSIYRDS 560




May be involved in membrane trafficking.
Arabidopsis thaliana (taxid: 3702)
>sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 Back     alignment and function description
>sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 Back     alignment and function description
>sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 Back     alignment and function description
>sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 Back     alignment and function description
>sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-b PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=2 SV=1 Back     alignment and function description
>sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query573
356562953565 PREDICTED: extended synaptotagmin-1-like 0.986 1.0 0.799 0.0
118484311566 unknown [Populus trichocarpa] 0.987 1.0 0.799 0.0
224144112566 plant synaptotagmin [Populus trichocarpa 0.987 1.0 0.797 0.0
449443041567 PREDICTED: synaptotagmin-5-like [Cucumis 0.987 0.998 0.792 0.0
255579863558 calcium lipid binding protein, putative 0.973 1.0 0.801 0.0
356562955557 PREDICTED: extended synaptotagmin-1-like 0.972 1.0 0.790 0.0
224120508566 plant synaptotagmin [Populus trichocarpa 0.987 1.0 0.790 0.0
225446229567 PREDICTED: extended synaptotagmin-1 [Vit 0.986 0.996 0.793 0.0
357478297566 Synaptotagmin-1 [Medicago truncatula] gi 0.963 0.975 0.787 0.0
186478159560 calcium-dependent lipid-binding domain-c 0.977 1.0 0.748 0.0
>gi|356562953|ref|XP_003549732.1| PREDICTED: extended synaptotagmin-1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
 Score =  964 bits (2491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/573 (79%), Positives = 513/573 (89%), Gaps = 8/573 (1%)

Query: 1   MGFFFGLVVGLVVGLGIIVGFVRSENARSKLRSELATTIAAFARMTVEDSKKILPAEFYP 60
           MGF FG+VVG++VGL IIVGFVR EN+R+  RS+LATT+AAFARMTVEDS+KILP +FYP
Sbjct: 1   MGFIFGVVVGIIVGLAIIVGFVRGENSRAAQRSQLATTVAAFARMTVEDSRKILPPQFYP 60

Query: 61  SWVVFSHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLG 120
           SWVVFS  QKL+WLN HL K+WPYVNEAASELIK+SVEP+LE+YRP +L++LKFSKFTLG
Sbjct: 61  SWVVFSSSQKLSWLNSHLTKIWPYVNEAASELIKASVEPILEEYRPVVLAALKFSKFTLG 120

Query: 121 TVAPQFTGVSIIEDGGSGVTMELEMQWDANSSIILAIKTRLGVALPVQVKNIGFTGVFRL 180
           TVAPQFTGVSIIEDGG GVTMELEMQWD N SIIL IKT LGVALPVQVKNIGFTGVFRL
Sbjct: 121 TVAPQFTGVSIIEDGGDGVTMELEMQWDGNPSIILDIKTLLGVALPVQVKNIGFTGVFRL 180

Query: 181 IFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGGDISTIPGLSDSIEATIHDAIEDSITW 240
           IF+PLVDEFPGF AVSYSLR+KKKLDF LKV+GGDIS IPGL D+IE  I DA+EDSITW
Sbjct: 181 IFKPLVDEFPGFGAVSYSLRQKKKLDFTLKVIGGDISAIPGLYDAIEGAIRDAVEDSITW 240

Query: 241 PVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKK 300
           PVRK+VPILPGDYS+LELKP G LEVKLVQAK LTNKD+IGKSDPYAV+++RPL E+ KK
Sbjct: 241 PVRKVVPILPGDYSDLELKPEGILEVKLVQAKELTNKDIIGKSDPYAVVYIRPLRERMKK 300

Query: 301 SKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKVK 360
           SKTINNDLNPIWNEHFEF+VED STQH+ V++YD EG+QSSELIGCAQ++L EL+PGKVK
Sbjct: 301 SKTINNDLNPIWNEHFEFVVEDVSTQHVTVKVYDSEGLQSSELIGCAQLQLSELQPGKVK 360

Query: 361 DVWLKLVKDLDVQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGEKA 420
           DVWLKLVKDL++QRDTK RGQVHLELLYCPFGMEN FTNPFAPN+SMTSLEKVL N    
Sbjct: 361 DVWLKLVKDLEIQRDTKNRGQVHLELLYCPFGMENSFTNPFAPNYSMTSLEKVLKN---- 416

Query: 421 LKSGANGTEAIELEKDASQKRREVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKS 480
               ANG E+   E   +QK++EVIIRGVLSVTVI AE+LPA+D MGK+DP+VVLT+KK+
Sbjct: 417 ----ANGVESNGNENAVTQKKKEVIIRGVLSVTVISAEDLPATDFMGKSDPFVVLTLKKA 472

Query: 481 ETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVWDHDTFGKDYMGRCILTLTRVIL 540
           ET+NKTRVVND LNP+WNQTFDFVVEDGLHDMLI EVWDHDTFGKDYMGRCILTLTRVIL
Sbjct: 473 ETKNKTRVVNDSLNPVWNQTFDFVVEDGLHDMLIVEVWDHDTFGKDYMGRCILTLTRVIL 532

Query: 541 EGEYTDCFELDGTKSGKLKLHLKWMPQPIYRDT 573
           EGEY + F LDG KSG L LHLKWMPQPI+RD+
Sbjct: 533 EGEYKERFVLDGAKSGFLNLHLKWMPQPIFRDS 565




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118484311|gb|ABK94033.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144112|ref|XP_002325190.1| plant synaptotagmin [Populus trichocarpa] gi|222866624|gb|EEF03755.1| plant synaptotagmin [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443041|ref|XP_004139289.1| PREDICTED: synaptotagmin-5-like [Cucumis sativus] gi|449517890|ref|XP_004165977.1| PREDICTED: synaptotagmin-5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255579863|ref|XP_002530768.1| calcium lipid binding protein, putative [Ricinus communis] gi|223529684|gb|EEF31628.1| calcium lipid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356562955|ref|XP_003549733.1| PREDICTED: extended synaptotagmin-1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|224120508|ref|XP_002331065.1| plant synaptotagmin [Populus trichocarpa] gi|222872995|gb|EEF10126.1| plant synaptotagmin [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225446229|ref|XP_002265034.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera] gi|296084522|emb|CBI25543.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357478297|ref|XP_003609434.1| Synaptotagmin-1 [Medicago truncatula] gi|355510489|gb|AES91631.1| Synaptotagmin-1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|186478159|ref|NP_172041.2| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] gi|75301121|sp|Q8L706.1|SYT5_ARATH RecName: Full=Synaptotagmin-5; AltName: Full=NTMC2T2.1; AltName: Full=Synaptotagmin E gi|22655178|gb|AAM98179.1| Ca2+-dependent lipid-binding protein, putative [Arabidopsis thaliana] gi|31711980|gb|AAP68346.1| At1g05500 [Arabidopsis thaliana] gi|110737090|dbj|BAF00497.1| putative Ca2+-dependent lipid-binding protein [Arabidopsis thaliana] gi|332189725|gb|AEE27846.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L706SYT5_ARATHNo assigned EC number0.74860.97731.0yesno
A0JJX5SYT4_ARATHNo assigned EC number0.70080.98770.9947nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00006418001
SubName- Full=Chromosome chr11 scaffold_170, whole genome shotgun sequence; (583 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query573
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 4e-35
smart00239101 smart00239, C2, Protein kinase C conserved region 2e-27
cd00030102 cd00030, C2, C2 domain 1e-26
pfam0016885 pfam00168, C2, C2 domain 2e-25
cd00030102 cd00030, C2, C2 domain 3e-25
smart00239101 smart00239, C2, Protein kinase C conserved region 3e-23
pfam0016885 pfam00168, C2, C2 domain 2e-22
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 3e-20
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 1e-19
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 5e-18
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 3e-17
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 9e-17
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 4e-16
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 5e-16
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 8e-16
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-15
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 1e-15
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-15
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 6e-15
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 7e-15
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 9e-15
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 4e-14
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 6e-14
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 1e-13
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 3e-13
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 9e-13
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 1e-12
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 1e-12
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 1e-12
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 2e-12
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 2e-12
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 3e-12
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 3e-12
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 3e-12
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 5e-12
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 6e-12
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 7e-12
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 9e-12
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 1e-11
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-11
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 3e-11
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 3e-11
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 3e-11
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 5e-11
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 6e-11
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 1e-10
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 1e-10
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 1e-10
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 1e-10
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 2e-10
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-10
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 3e-10
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 3e-10
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 3e-10
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 4e-10
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 4e-10
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 5e-10
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 7e-10
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 1e-09
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 1e-09
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 1e-09
cd04047110 cd04047, C2B_Copine, C2 domain second repeat in Co 1e-09
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 2e-09
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 2e-09
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 2e-09
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 2e-09
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 2e-09
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 2e-09
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 2e-09
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 2e-09
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 3e-09
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 3e-09
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 4e-09
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 4e-09
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 4e-09
cd04048120 cd04048, C2A_Copine, C2 domain first repeat in Cop 4e-09
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 9e-09
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 1e-08
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 1e-08
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 1e-08
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 1e-08
cd08382123 cd08382, C2_Smurf-like, C2 domain present in Smad 2e-08
cd08382123 cd08382, C2_Smurf-like, C2 domain present in Smad 2e-08
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 2e-08
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 5e-08
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 6e-08
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 8e-08
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 8e-08
cd04047110 cd04047, C2B_Copine, C2 domain second repeat in Co 1e-07
cd04048120 cd04048, C2A_Copine, C2 domain first repeat in Cop 1e-07
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 1e-07
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 1e-07
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 1e-07
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 2e-07
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 2e-07
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 3e-07
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 5e-07
cd04021125 cd04021, C2_E3_ubiquitin_ligase, C2 domain present 8e-07
cd04021125 cd04021, C2_E3_ubiquitin_ligase, C2 domain present 9e-07
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 1e-06
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 1e-06
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 2e-06
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 2e-06
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 2e-06
cd08401121 cd08401, C2A_RasA2_RasA3, C2 domain first repeat p 2e-06
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 3e-06
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 4e-06
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 4e-06
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 4e-06
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 6e-06
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 8e-06
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 9e-06
PLN032002102 PLN03200, PLN03200, cellulose synthase-interactive 1e-05
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 1e-05
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 1e-05
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 2e-05
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 3e-05
cd08678126 cd08678, C2_C21orf25-like, C2 domain found in the 3e-05
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 4e-05
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 7e-05
cd04039108 cd04039, C2_PSD, C2 domain present in Phosphatidyl 9e-05
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 1e-04
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 1e-04
cd08393125 cd08393, C2A_SLP-1_2, C2 domain first repeat prese 2e-04
cd04029125 cd04029, C2A_SLP-4_5, C2 domain first repeat prese 3e-04
cd04015158 cd04015, C2_plant_PLD, C2 domain present in plant 3e-04
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 4e-04
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 6e-04
cd08389124 cd08389, C2A_Synaptotagmin-14_16, C2A domain first 8e-04
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 8e-04
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 0.002
cd08678126 cd08678, C2_C21orf25-like, C2 domain found in the 0.002
cd08685119 cd08685, C2_RGS-like, C2 domain of the Regulator O 0.002
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 0.003
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 0.004
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
 Score =  141 bits (356), Expect = 4e-35
 Identities = 121/538 (22%), Positives = 202/538 (37%), Gaps = 103/538 (19%)

Query: 71  LTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVS 130
           + WLN  L+K WP +  + S+ +   V   L +  P  + +L   +FTLG+  P+  G+ 
Sbjct: 223 VEWLNTFLQKFWPIIEPSISQQVVDQVNQQLAEAIPSFIDALALDEFTLGSKPPRIDGIR 282

Query: 131 IIEDGGSGVTMELEMQWDA-------------------NSSIILAIK--TRLGVA-LPVQ 168
                 S     + M  D                    N  I L +K     G   LP+ 
Sbjct: 283 SYPSTESDT---VVMDVDFSFTPHDISDVTATSARASVNPKISLVVKKGKSFGSFTLPIL 339

Query: 169 VKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLDFKLKVVGG-----DISTIPGLS 223
           V+++ F G  R+    L+ ++P    VS+ L E  + DF L  +GG     DI  IPGLS
Sbjct: 340 VEDLFFKGRVRVRVE-LMSKYPFIKTVSFQLLEVPEFDFILVPLGGDFFGVDIFAIPGLS 398

Query: 224 DSIEATIHDAIEDSITWPVRKIVPI-LPGDYSELELKPVGTLEVKLVQAKGLTNKDLI-- 280
             I+  I+  +   +  P    + I +    +      +G +EVK+  A+GL   D    
Sbjct: 399 RFIQEIINSTLGPMLLPP--NSLTIDISQIMAGDSGTAIGVVEVKIKSAEGLKKSDSTIN 456

Query: 281 GKSDPYAVL----FVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDE 336
           G  DPY  +     V        K++   N LNP+WNE F +I+ +  T  L + +YD  
Sbjct: 457 GTVDPYITVTFSDRVIG------KTRVKKNTLNPVWNETF-YILLNSFTDPLNLSLYDFN 509

Query: 337 GIQSSELIGCAQVRLCELEPGKVKDVWLKLVKDLDVQ--RDTKYRGQVHLELLYCPFGME 394
             +S +++G  Q+ L  L    VK       K+   +  R+TK  G++  +L + P   +
Sbjct: 510 SFKSDKVVGSTQLDLALLHQNPVK-------KNELYEFLRNTKNVGRLTYDLRFFPVIED 562

Query: 395 NVFTNPFAPNFSMTSLEKVLTNGEKALKSGANGTEAIELEKDASQKRREVIIRGVLSVTV 454
                                                  E   S +  E    G+L VT+
Sbjct: 563 K-------------------------------------KELKGSVEPLEDSNTGILKVTL 585

Query: 455 ILAENLPASDLMGKADPYVVLTMKKSE--TRNKTRVVNDCLNPIWNQTFDFVVEDGLHDM 512
              + L             + T  K    T           +P WN  ++ +V D  +  
Sbjct: 586 REVKALDELSSKKDNKSAELYTNAKEVYSTGKLKFTN----HPSWNLQYNVLVTDRKNSS 641

Query: 513 LIAEVWDHDTFGKDYMGRCILTLTRVILEGEYTDCFELDGTKSGKLKLHLKWMPQPIY 570
           +    +D  +     +     TL  +I      D F +   ++ K ++ +    +PIY
Sbjct: 642 IKVVTFDVQS--GKVIATEGSTLPDLIDRTL--DTFLVFPLRNPKGRIFITNYWKPIY 695


Length = 1227

>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine Back     alignment and domain information
>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>gnl|CDD|176067 cd08685, C2_RGS-like, C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 573
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 100.0
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.97
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.9
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.88
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.85
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.85
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.85
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.83
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.83
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.82
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.82
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.82
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.82
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.82
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.82
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.82
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.81
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.81
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.81
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.81
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.81
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.81
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.81
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.81
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.81
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.8
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.8
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.8
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.8
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.79
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.79
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.79
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.79
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.79
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.79
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.79
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.79
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.79
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.79
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.78
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.78
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.78
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.78
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.78
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.78
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.78
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.77
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.77
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.77
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.77
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.77
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.77
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.77
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.77
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.77
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.76
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.76
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.76
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.76
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.76
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.75
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.75
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.75
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.75
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.75
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.75
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.75
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.75
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.74
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.74
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.74
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.74
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.74
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.74
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.74
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.74
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.74
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.74
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.74
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.74
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.73
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.73
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.73
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.73
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.73
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.73
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.73
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.72
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.72
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.72
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.72
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.72
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.72
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.72
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.72
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.72
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.71
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.71
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.71
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.71
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.71
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.71
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.71
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.71
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.7
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.7
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.7
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.7
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.69
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.69
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.69
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.69
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.69
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.69
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.69
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.69
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.68
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.68
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.68
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.68
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.68
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.68
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.68
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.68
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.67
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.67
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.67
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.67
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.67
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.67
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.67
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.66
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.66
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.66
PLN03008 868 Phospholipase D delta 99.66
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.66
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.66
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.66
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.65
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.65
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.65
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.64
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.64
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.64
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.64
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.64
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.63
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.63
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.63
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.63
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.63
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.63
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.63
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.63
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.63
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.63
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.62
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.62
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.62
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.62
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.62
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.62
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.62
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.61
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.61
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.61
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.61
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.61
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.61
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.61
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.6
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.6
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.6
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.6
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.6
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.6
PLN03008 868 Phospholipase D delta 99.6
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.6
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.59
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.59
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.59
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.59
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.58
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.58
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.57
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.57
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.55
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.55
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.53
KOG1028 421 consensus Ca2+-dependent phospholipid-binding prot 99.53
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.52
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.51
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.51
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.46
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.41
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.38
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.37
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.34
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.3
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.28
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.26
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.24
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 99.23
PLN02223537 phosphoinositide phospholipase C 99.2
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.19
PLN02270 808 phospholipase D alpha 99.18
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.17
PF1029691 DUF2404: Putative integral membrane protein conser 99.15
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.14
PLN02270 808 phospholipase D alpha 99.14
PLN02952599 phosphoinositide phospholipase C 99.11
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 99.06
PLN02223537 phosphoinositide phospholipase C 99.06
PLN02230598 phosphoinositide phospholipase C 4 99.01
PLN02222581 phosphoinositide phospholipase C 2 98.97
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.96
PLN02228567 Phosphoinositide phospholipase C 98.95
PLN02228567 Phosphoinositide phospholipase C 98.95
PLN02952599 phosphoinositide phospholipase C 98.93
KOG1327 529 consensus Copine [Signal transduction mechanisms] 98.92
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.92
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.91
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.88
PLN02230598 phosphoinositide phospholipase C 4 98.85
PLN02222581 phosphoinositide phospholipase C 2 98.8
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.76
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.76
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.76
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.75
PLN02352 758 phospholipase D epsilon 98.66
PLN02352 758 phospholipase D epsilon 98.61
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.6
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.58
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.53
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.32
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.21
KOG1327529 consensus Copine [Signal transduction mechanisms] 98.2
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 98.01
KOG3532 1051 consensus Predicted protein kinase [General functi 97.89
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.88
PLN02964 644 phosphatidylserine decarboxylase 97.87
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.82
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.75
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.58
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.57
KOG3837523 consensus Uncharacterized conserved protein, conta 97.39
PLN02964 644 phosphatidylserine decarboxylase 97.23
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.11
KOG3837523 consensus Uncharacterized conserved protein, conta 97.03
PF15627156 CEP76-C2: CEP76 C2 domain 96.88
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 96.6
PF15627156 CEP76-C2: CEP76 C2 domain 96.55
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 96.0
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 95.99
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.45
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.29
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 95.06
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 94.99
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 94.52
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 94.5
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 94.41
cd08397159 C2_PI3K_class_III C2 domain present in class III p 94.22
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 93.41
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 93.25
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 92.88
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 92.82
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 92.64
KOG1452442 consensus Predicted Rho GTPase-activating protein 92.47
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 91.59
cd08397159 C2_PI3K_class_III C2 domain present in class III p 90.85
KOG1452 442 consensus Predicted Rho GTPase-activating protein 90.61
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 90.59
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 90.09
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 89.47
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 88.59
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 87.94
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 87.68
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 86.86
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 85.02
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 84.42
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 81.78
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 81.11
KOG2238795 consensus Uncharacterized conserved protein TEX2, 80.18
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=2.5e-56  Score=478.17  Aligned_cols=451  Identities=25%  Similarity=0.402  Sum_probs=376.9

Q ss_pred             CcccchHHHHHHHHhhChhhHHHHHHHHHHhHHHHHhhhCCCccceEEEeEEecCCCCceEeEEEEEEc-CCCeEEEEEe
Q 008214           66 SHRQKLTWLNHHLEKLWPYVNEAASELIKSSVEPVLEQYRPFILSSLKFSKFTLGTVAPQFTGVSIIED-GGSGVTMELE  144 (573)
Q Consensus        66 ~~~E~~~WlN~~l~~~Wp~~~~~~~~~~~~~~~~~l~~~~p~~l~~i~~~~~~lG~~pP~i~~i~~~~~-~~~~~~le~~  144 (573)
                      .|+|++||||.+|+++||.+++.+++.+.+++|+.|++..|+||+.+.+.+||||++||||.+||.|+. +.+.+.||++
T Consensus       218 nd~ESveWLNtfL~KfW~i~eP~iSqqV~dqvn~~la~~iPsFI~~l~l~efTLGsk~PrI~~Irsyp~te~dtv~mD~~  297 (1227)
T COG5038         218 NDYESVEWLNTFLQKFWPIIEPSISQQVVDQVNQQLAEAIPSFIDALALDEFTLGSKPPRIDGIRSYPSTESDTVVMDVD  297 (1227)
T ss_pred             cchhHHHHHHHHHHhheeccChHHHHHHHHHHHHHHHhhcchhhhhhhhhhcccCCCCCceeeeeecCCCCCceEEEEee
Confidence            578999999999999999999999999999999999999999999999999999999999999999988 7799999999


Q ss_pred             eEEec---------------CcceEEEEee--eec-eeeeEEEEEEEEEEEEEEEeecCCcCCCeeeEEEEEecccceee
Q 008214          145 MQWDA---------------NSSIILAIKT--RLG-VALPVQVKNIGFTGVFRLIFRPLVDEFPGFAAVSYSLREKKKLD  206 (573)
Q Consensus       145 ~~~~~---------------~~~i~l~~~~--~~g-~~~~v~v~~~~~~g~~rv~l~pl~~~~P~~~~~~~~f~~~p~l~  206 (573)
                      +++..               ++.|.|.++.  .+| +++||.|+++.|+|++|++++ |++.+|++..+.++|++.|.+|
T Consensus       298 ~sftP~d~sD~t~~~~r~~vn~kIsL~v~~Gk~~~~~~lPI~Vedl~f~g~~Rvr~~-L~~~~PfiktV~~~Lle~Pe~d  376 (1227)
T COG5038         298 FSFTPHDISDVTATSARASVNPKISLVVKKGKSFGSFTLPILVEDLFFKGRVRVRVE-LMSKYPFIKTVSFQLLEVPEFD  376 (1227)
T ss_pred             eccCccchhhhhhHHHhhhcCcceeEEEEeeeeeeEEeccEEEEeeeeeEEEEEEEE-ecCCCcceeEEEEEEecCccee
Confidence            99963               3457777753  445 789999999999999999999 9999999999999999999999


Q ss_pred             EEEEEcc-----ccccCCcchHHHHHHHHHHHHHhcccccceeeecCCCCCCcccccCcceEEEEEEEEeeeccCCC--C
Q 008214          207 FKLKVVG-----GDISTIPGLSDSIEATIHDAIEDSITWPVRKIVPILPGDYSELELKPVGTLEVKLVQAKGLTNKD--L  279 (573)
Q Consensus       207 f~~~~~g-----~~~~~iP~l~~~~~~~i~~~i~~~~~~P~~~~ipl~~~~~~~~~~~~~G~L~V~v~~a~~L~~~d--~  279 (573)
                      |.++++|     .||+.+|||+.|++++|...++.++++|+.+.+++..-- ......+.|++.|+|.+|++|...+  .
T Consensus       377 f~l~Plg~~~~g~dI~~iPGL~~fI~~~i~~~l~pml~~Pnsl~idi~~~m-~~~s~~aIGVv~vkI~sa~~lk~~d~~i  455 (1227)
T COG5038         377 FILVPLGGDFFGVDIFAIPGLSRFIQEIINSTLGPMLLPPNSLTIDISQIM-AGDSGTAIGVVEVKIKSAEGLKKSDSTI  455 (1227)
T ss_pred             EEEEEcCCCccceeEecCccHHHHHHHHHHhhcCCeeeCCceEEEcHHHhh-ccccCCeeEEEEEEEeeccCcccccccc
Confidence            9999987     378999999999999999999999999999999764210 1113468999999999999999888  5


Q ss_pred             CCCCCcEEEEEEecCCCCeEEeeeeCCCCCceeccEEEEEEecCCCcEEEEEEEeCCCCCCCCceEEEEEEccccCCCce
Q 008214          280 IGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEPGKV  359 (573)
Q Consensus       280 ~g~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~w~e~f~f~v~~~~~~~l~i~v~d~~~~~~d~~lG~~~i~l~~l~~~~~  359 (573)
                      .+..|||+.+...  +....||++.+++.||+|||+|++.+... ++.|.++|||.+....|+.+|++.++|..|...+.
T Consensus       456 ~~~vDpyit~~~~--~r~~gkT~v~~nt~nPvwNEt~Yi~lns~-~d~L~LslyD~n~~~sd~vvG~~~l~L~~L~~~~~  532 (1227)
T COG5038         456 NGTVDPYITVTFS--DRVIGKTRVKKNTLNPVWNETFYILLNSF-TDPLNLSLYDFNSFKSDKVVGSTQLDLALLHQNPV  532 (1227)
T ss_pred             cCCCCceEEEEec--cccCCccceeeccCCccccceEEEEeccc-CCceeEEEEeccccCCcceeeeEEechHHhhhccc
Confidence            7899999999975  34456999999999999999999998854 56999999999888999999999999999866554


Q ss_pred             eEE-EEEeeecccccCCCcceeEEEEEEEEeecCCCCCccCCCCCCCChhhHHHHhccCcccccCCCCCcchhhhchhhh
Q 008214          360 KDV-WLKLVKDLDVQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVLTNGEKALKSGANGTEAIELEKDAS  438 (573)
Q Consensus       360 ~~~-w~~L~~~~~~~~~~~~~G~i~l~l~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  438 (573)
                      ... .+.+      .++.+..|+++..+.|+|.-.+.....+.                    .+..             
T Consensus       533 ~~ne~~e~------~~~~k~vGrL~yDl~ffp~~e~k~~~~~s--------------------~e~~-------------  573 (1227)
T COG5038         533 KKNELYEF------LRNTKNVGRLTYDLRFFPVIEDKKELKGS--------------------VEPL-------------  573 (1227)
T ss_pred             cccceeee------eccCccceEEEEeeeeecccCCccccccc--------------------cCCc-------------
Confidence            332 2322      34678899999999999854332111000                    0000             


Q ss_pred             ccccccceeeEEEEEEEEeecCCCCCCCCCCCcEEEEEEcCcceeEeecccCCCCCCeeeeEEEEEeccCCCCEEEEEEE
Q 008214          439 QKRREVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKSETRNKTRVVNDCLNPIWNQTFDFVVEDGLHDMLIAEVW  518 (573)
Q Consensus       439 ~~~~~~~~~~~L~V~v~~a~~L~~~~~~~~~dpyv~v~l~~~~~~~kT~~~~~t~nP~wne~f~f~v~~~~~~~L~i~V~  518 (573)
                          .....|++.+++.++.+|.... ......|++++++. ...+.|+.++.+.+|.||+.+.-.+.+..+..+.+.++
T Consensus       574 ----ed~n~GI~k~tl~~~~~l~~~~-~~~~~~~a~l~~~~-keV~st~~~k~t~~~~wn~~~~~~v~~~~ns~~~~~~~  647 (1227)
T COG5038         574 ----EDSNTGILKVTLREVKALDELS-SKKDNKSAELYTNA-KEVYSTGKLKFTNHPSWNLQYNVLVTDRKNSSIKVVTF  647 (1227)
T ss_pred             ----ccCCcceeEEEeeccccccCcc-ccccceeEEEEecc-eEEeccceeeeccCCceeeecceEeccCcceeEEEEec
Confidence                0134699999999999997642 12233458888874 46778888999999999999999999888889999999


Q ss_pred             eCCCCCCceeEEEEEEcceeeecC-eEeEEEEcCCCCCeEEEEEEEEEecCC
Q 008214          519 DHDTFGKDYMGRCILTLTRVILEG-EYTDCFELDGTKSGKLKLHLKWMPQPI  569 (573)
Q Consensus       519 d~~~~~~d~lG~~~i~l~~l~~~~-~~~~~~~L~~~~~G~i~l~l~~~p~~~  569 (573)
                      |..  ..+.+|....+|.+++... ...+||++. .++|+|.++-.|+|.+.
T Consensus       648 d~~--~g~~i~~~~~~l~~li~~t~dt~~~f~~~-~~kg~I~~t~~W~Pi~~  696 (1227)
T COG5038         648 DVQ--SGKVIATEGSTLPDLIDRTLDTFLVFPLR-NPKGRIFITNYWKPIYN  696 (1227)
T ss_pred             ccc--cCceeccccccchHhhhccccceEEEEcC-CCcceEEEEeccceeec
Confidence            876  3578899888888877653 457999998 67899999999999876



>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PF10296 DUF2404: Putative integral membrane protein conserved region (DUF2404); InterPro: IPR019411 This is entry represents a domain of unknown function found in mitochondrial distribution and morphology proteins Mdm12 and Mdm34, and in maintenance of mitochondrial morphology protein Mmm1 Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>KOG2238 consensus Uncharacterized conserved protein TEX2, contains PH domain [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query573
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 1e-09
1a25_A149 C2 Domain From Protein Kinase C (Beta) Length = 149 3e-09
1rlw_A126 Calcium-Phospholipid Binding Domain From Cytosolic 6e-09
1rlw_A126 Calcium-Phospholipid Binding Domain From Cytosolic 1e-05
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 7e-09
1bci_A138 C2 Domain Of Cytosolic Phospholipase A2, Nmr, Minim 9e-09
1bci_A138 C2 Domain Of Cytosolic Phospholipase A2, Nmr, Minim 2e-05
1wfj_A136 C2 Domain-Containing Protein From Putative Elicitor 2e-08
1wfj_A136 C2 Domain-Containing Protein From Putative Elicitor 1e-05
1cjy_A 749 Human Cytosolic Phospholipase A2 Length = 749 2e-08
1cjy_A 749 Human Cytosolic Phospholipase A2 Length = 749 1e-05
2uzp_A144 Crystal Structure Of The C2 Domain Of Human Protein 2e-08
3gpe_A137 Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain 2e-08
1dsy_A139 C2 Domain From Protein Kinase C (Alpha) Complexed W 2e-08
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 3e-08
4dnl_A140 Crystal Structure Of A C2 Domain Of A Protein Kinas 7e-08
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 7e-08
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 8e-08
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 3e-06
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 3e-07
2chd_A142 Crystal Structure Of The C2a Domain Of Rabphilin-3a 7e-07
2chd_A142 Crystal Structure Of The C2a Domain Of Rabphilin-3a 4e-05
2k3h_A140 Structural Determinants For Ca2+ And Pip2 Binding B 8e-07
2k3h_A140 Structural Determinants For Ca2+ And Pip2 Binding B 5e-05
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 3e-06
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 1e-05
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 3e-06
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 1e-05
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 3e-06
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 1e-05
2r83_A284 Crystal Structure Analysis Of Human Synaptotagmin 1 3e-06
2r83_A 284 Crystal Structure Analysis Of Human Synaptotagmin 1 1e-05
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 4e-06
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 1e-05
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 5e-06
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 7e-06
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 6e-06
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 7e-06
1rh8_A142 Three-Dimensional Structure Of The Calcium-Free Pic 8e-06
3b7y_A153 Crystal Structure Of The C2 Domain Of The E3 Ubiqui 8e-06
3b7y_A153 Crystal Structure Of The C2 Domain Of The E3 Ubiqui 8e-05
3pyc_A132 Crystal Structure Of Human Smurf1 C2 Domain Length 2e-05
2jqz_A131 Solution Structure Of The C2 Domain Of Human Smurf2 2e-05
2cm6_A166 Crystal Structure Of The C2b Domain Of Rabphilin3a 2e-05
3m7f_B176 Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX 3e-05
3m7f_B176 Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX 3e-04
2cm5_A166 Crystal Structure Of The C2b Domain Of Rabphilin Le 5e-05
3rpb_A140 The C2b-Domain Of Rabphilin: Structural Variations 5e-05
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure

Iteration: 1

Score = 61.6 bits (148), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 41/104 (39%), Positives = 58/104 (55%), Gaps = 10/104 (9%) Query: 436 DASQKRREVII-----RGVLSVTVILAENLPASDLMGKADPYVVLTM---KKSETRNKTR 487 D +++R + I R VL V V A+NL D G +DPYV L + KSE++ KT+ Sbjct: 155 DHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTK 214 Query: 488 VVNDCLNPIWNQTFDFVVEDGLHD-MLIAEVWDHD-TFGKDYMG 529 + LNP WN+TF F +++ D L E+WD D T D+MG Sbjct: 215 TIKSSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMG 258
>pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 Back     alignment and structure
>pdb|1RLW|A Chain A, Calcium-Phospholipid Binding Domain From Cytosolic Phospholipase A2 Length = 126 Back     alignment and structure
>pdb|1RLW|A Chain A, Calcium-Phospholipid Binding Domain From Cytosolic Phospholipase A2 Length = 126 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|1BCI|A Chain A, C2 Domain Of Cytosolic Phospholipase A2, Nmr, Minimized Average Structure Length = 138 Back     alignment and structure
>pdb|1BCI|A Chain A, C2 Domain Of Cytosolic Phospholipase A2, Nmr, Minimized Average Structure Length = 138 Back     alignment and structure
>pdb|1WFJ|A Chain A, C2 Domain-Containing Protein From Putative Elicitor- Responsive Gene Length = 136 Back     alignment and structure
>pdb|1WFJ|A Chain A, C2 Domain-Containing Protein From Putative Elicitor- Responsive Gene Length = 136 Back     alignment and structure
>pdb|1CJY|A Chain A, Human Cytosolic Phospholipase A2 Length = 749 Back     alignment and structure
>pdb|1CJY|A Chain A, Human Cytosolic Phospholipase A2 Length = 749 Back     alignment and structure
>pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 Back     alignment and structure
>pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 Back     alignment and structure
>pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 Back     alignment and structure
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure
>pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 Back     alignment and structure
>pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 Back     alignment and structure
>pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 Back     alignment and structure
>pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 Back     alignment and structure
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 Back     alignment and structure
>pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 Back     alignment and structure
>pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 Back     alignment and structure
>pdb|3PYC|A Chain A, Crystal Structure Of Human Smurf1 C2 Domain Length = 132 Back     alignment and structure
>pdb|2JQZ|A Chain A, Solution Structure Of The C2 Domain Of Human Smurf2 Length = 131 Back     alignment and structure
>pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 Back     alignment and structure
>pdb|3M7F|B Chain B, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 176 Back     alignment and structure
>pdb|3M7F|B Chain B, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 176 Back     alignment and structure
>pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 Back     alignment and structure
>pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query573
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 3e-40
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 8e-32
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 8e-40
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 7e-27
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 4e-37
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 2e-28
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 3e-36
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 3e-27
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 5e-36
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 1e-32
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 1e-35
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 3e-31
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 1e-35
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 1e-18
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 4e-15
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 2e-33
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 1e-17
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 2e-32
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 3e-24
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 3e-30
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 1e-21
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 3e-29
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 9e-27
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 4e-28
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 6e-27
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 5e-27
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 1e-26
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 6e-27
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 4e-21
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 2e-24
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 4e-22
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 8e-24
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 4e-21
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 1e-23
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 2e-23
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 1e-23
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 8e-23
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 3e-23
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 1e-18
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 8e-23
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 6e-22
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 1e-22
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 2e-19
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-22
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-22
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 5e-22
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 3e-17
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 6e-22
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 2e-17
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 1e-20
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 3e-17
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 1e-20
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 7e-19
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 4e-20
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 1e-17
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 4e-20
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 2e-17
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 1e-19
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 4e-16
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 2e-19
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 3e-18
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 2e-19
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 1e-09
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 2e-19
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 9e-19
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 3e-19
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 1e-17
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 4e-19
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 5e-16
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 4e-19
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 1e-15
3nsj_A540 Perforin-1; pore forming protein, immune system; H 8e-19
3nsj_A540 Perforin-1; pore forming protein, immune system; H 8e-12
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-18
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-17
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 1e-18
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-18
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 3e-12
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 6e-08
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 5e-12
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 3e-11
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 3e-09
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 2e-06
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 1e-07
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 6e-06
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 2e-07
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 9e-07
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 3e-05
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
 Score =  141 bits (358), Expect = 3e-40
 Identities = 42/138 (30%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 259 KPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEF 318
            P GTLEV LV AKGL + D +   DPY  L  R   +  K +        P WNE F F
Sbjct: 7   GPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCR--TQDQKSNVAEGMGTTPEWNETFIF 64

Query: 319 IVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCEL-EPGKVKDVWLKLVKDLDVQRDTK 377
            V + +T+ L  +I+D +     + +G A + L  +   G +      +VK      D +
Sbjct: 65  TVSEGTTE-LKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVK------DEE 117

Query: 378 YRGQVHLELLYCPFGMEN 395
           Y+G++ + L + P G  +
Sbjct: 118 YKGEIWVALSFKPSGPSS 135


>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Length = 799 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query573
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 100.0
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 100.0
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.85
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.85
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.84
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.84
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.84
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.83
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.83
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.82
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.82
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.82
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.82
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.81
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.8
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.8
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.79
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.79
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.79
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.79
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.78
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.78
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.78
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.78
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.78
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.77
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.77
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.77
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.77
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.77
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.76
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.76
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.76
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.76
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.75
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.75
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.75
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.75
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.75
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.75
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.75
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.75
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.74
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.74
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.74
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.74
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.74
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.73
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.73
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.73
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.73
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.73
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.73
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.73
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.73
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.72
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.72
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.72
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.72
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.71
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.71
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.71
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.71
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.71
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.7
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.69
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.69
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.69
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.68
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.65
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.64
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.64
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.63
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.63
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.62
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.6
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.58
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.56
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.55
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.54
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.52
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.49
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.46
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.44
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.42
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.38
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.23
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.19
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.16
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.15
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.15
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.07
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.06
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.04
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.99
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.92
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.88
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.83
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 93.52
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 90.6
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 89.66
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 89.57
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 86.34
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 80.9
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=100.00  E-value=8.9e-35  Score=289.65  Aligned_cols=240  Identities=28%  Similarity=0.453  Sum_probs=203.6

Q ss_pred             ccCcceEEEEEEEEeeeccCCCCCCCCCcEEEEEEecCCCCeEEeeeeCCCCCceeccEEEEEEecC--CCcEEEEEEEe
Q 008214          257 ELKPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDE--STQHLVVRIYD  334 (573)
Q Consensus       257 ~~~~~G~L~V~v~~a~~L~~~d~~g~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~w~e~f~f~v~~~--~~~~l~i~v~d  334 (573)
                      +....|.|+|+|++|++|+.+|..|.+||||++++.+...+.++|+++++++||+|||+|.|.+...  ....|.|+|||
T Consensus        14 y~~~~~~L~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~wne~f~f~v~~~~~~~~~l~~~V~d   93 (284)
T 2r83_A           14 YDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELAGKTLVMAVYD   93 (284)
T ss_dssp             EETTTTEEEEEEEEEECCCCCSSSSSCCEEEEEEEETCTTSCEECCCCCSCSSCEEEEEEEECCCGGGCTTCEEEEEEEE
T ss_pred             EECCCCEEEEEEEEeeCCCCCCCCCCCCeEEEEEEEcCCCceEeCCcccCCCCCeeCceEEEEechHHhCcCEEEEEEEE
Confidence            3457899999999999999999889999999999986656789999999999999999999998643  45799999999


Q ss_pred             CCCCCCCCceEEEEEEccccCCCceeEEEEEeeecccccCCCcceeEEEEEEEEeecCCCCCccCCCCCCCChhhHHHHh
Q 008214          335 DEGIQSSELIGCAQVRLCELEPGKVKDVWLKLVKDLDVQRDTKYRGQVHLELLYCPFGMENVFTNPFAPNFSMTSLEKVL  414 (573)
Q Consensus       335 ~~~~~~d~~lG~~~i~l~~l~~~~~~~~w~~L~~~~~~~~~~~~~G~i~l~l~~~p~~~~~~~~~~~~~~~~~~~~~~~~  414 (573)
                      ++.+++|++||++.++|.++..+.....|++|.....  ......|+|.+.+.|.|                        
T Consensus        94 ~d~~~~~~~lG~~~i~l~~l~~~~~~~~w~~L~~~~~--~~~~~~G~i~l~l~~~p------------------------  147 (284)
T 2r83_A           94 FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVP------------------------  147 (284)
T ss_dssp             CCSSSCCCEEEEEEEEGGGCCCSSCEEEEEECBCCSS--CCCCCCCEEEEEEEEET------------------------
T ss_pred             CCCCCCCceeEEEEEcchhcccCCcceeEEEeecccc--ccccccccEEEEEEecC------------------------
Confidence            9999899999999999999988888899999975321  12356799999999864                        


Q ss_pred             ccCcccccCCCCCcchhhhchhhhccccccceeeEEEEEEEEeecCCCCCCCCCCCcEEEEEEcCc---ceeEeecccCC
Q 008214          415 TNGEKALKSGANGTEAIELEKDASQKRREVIIRGVLSVTVILAENLPASDLMGKADPYVVLTMKKS---ETRNKTRVVND  491 (573)
Q Consensus       415 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~V~v~~a~~L~~~~~~~~~dpyv~v~l~~~---~~~~kT~~~~~  491 (573)
                                                     ..+.|.|+|++|++|+..+..|.+||||++++...   ..+++|+++++
T Consensus       148 -------------------------------~~~~l~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~~kT~v~~~  196 (284)
T 2r83_A          148 -------------------------------TAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKN  196 (284)
T ss_dssp             -------------------------------TTTEEEEEEEEEESCCCCSTTSCCCEEEEEEEEETTEEEEEEECCCCCS
T ss_pred             -------------------------------cCCceEEEEEEeECCCCcCCCCCcCeEEEEEEEeCCcEeeeeccceecC
Confidence                                           23789999999999999999999999999998531   24689999999


Q ss_pred             CCCCeeeeEEEEEeccC--CCCEEEEEEEeCCCCCC-ceeEEEEEEcceeee------------cCeEeEEEEcCCC
Q 008214          492 CLNPIWNQTFDFVVEDG--LHDMLIAEVWDHDTFGK-DYMGRCILTLTRVIL------------EGEYTDCFELDGT  553 (573)
Q Consensus       492 t~nP~wne~f~f~v~~~--~~~~L~i~V~d~~~~~~-d~lG~~~i~l~~l~~------------~~~~~~~~~L~~~  553 (573)
                      |.||.|||+|.|.+...  ....|.|+|||++..+. ++||++.|+++.+..            .....+||+|.+.
T Consensus       197 t~nP~wne~f~f~v~~~~l~~~~l~i~V~d~d~~~~~~~iG~~~i~l~~~~~~~~~w~~~~~~~~~~~~~W~~L~~~  273 (284)
T 2r83_A          197 TLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVE  273 (284)
T ss_dssp             CSSCEEEEEEEEECCTTTGGGEEEEEEEEECCSSSCCCEEEEEEEETTCCHHHHHHHHHHHHSTTSCEEEEEECBCH
T ss_pred             CCCCEEceeEEEeCCHHHhCceEEEEEEEeCCCCCCCcEEEEEEECCCCCCcHHHHHHHHHHCCCCchheeeecCCc
Confidence            99999999999998743  24579999999998865 699999999986321            2345799999864



>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 573
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-26
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 3e-22
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 8e-23
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 3e-22
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 2e-21
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 3e-15
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-21
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-17
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 4e-21
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 1e-19
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 3e-19
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 5e-17
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 2e-16
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 8e-16
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 4e-16
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 4e-15
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 6e-16
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 3e-13
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 1e-15
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 1e-15
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 1e-15
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 6e-15
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 4e-15
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-13
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 1e-14
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 1e-14
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 2e-14
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 5e-14
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 2e-14
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 1e-13
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 4e-14
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 5e-12
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 9e-14
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 2e-10
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 5e-12
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 1e-11
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 1e-10
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 4e-09
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score =  102 bits (256), Expect = 1e-26
 Identities = 41/138 (29%), Positives = 66/138 (47%), Gaps = 10/138 (7%)

Query: 259 KPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEF 318
            P GTLEV LV AKGL + D +   DPY  L  R   +K+  ++ +     P WNE F F
Sbjct: 7   GPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMG--TTPEWNETFIF 64

Query: 319 IVEDESTQHLVVRIYDDEGIQSSELIGCAQVRLCELEP-GKVKDVWLKLVKDLDVQRDTK 377
            V + +   L  +I+D +     + +G A + L  +   G +      +VKD       +
Sbjct: 65  TVSEGT-TELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDE------E 117

Query: 378 YRGQVHLELLYCPFGMEN 395
           Y+G++ + L + P G  +
Sbjct: 118 YKGEIWVALSFKPSGPSS 135


>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query573
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.86
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.85
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.85
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.84
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.81
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.8
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.79
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.78
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.78
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.78
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.78
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.77
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.76
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.75
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.74
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.74
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.73
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.73
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.72
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.7
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.7
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.7
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.69
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.69
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.68
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.68
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.68
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.67
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.67
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.66
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.65
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.65
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.64
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.64
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.59
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.59
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.58
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.55
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.38
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.32
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 93.81
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 87.29
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=8.1e-22  Score=168.47  Aligned_cols=122  Identities=29%  Similarity=0.548  Sum_probs=106.4

Q ss_pred             CcceEEEEEEEEeeeccCCCCCCCCCcEEEEEEecCCCCeEEeeeeCCCCCceeccEEEEEEecCCCcEEEEEEEeCCCC
Q 008214          259 KPVGTLEVKLVQAKGLTNKDLIGKSDPYAVLFVRPLPEKTKKSKTINNDLNPIWNEHFEFIVEDESTQHLVVRIYDDEGI  338 (573)
Q Consensus       259 ~~~G~L~V~v~~a~~L~~~d~~g~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~w~e~f~f~v~~~~~~~l~i~v~d~~~~  338 (573)
                      ++.|.|+|+|++|++|+.++..|.+||||+++++   +++++|++++++.||.|||+|.|.+.++. +.|.|+|||++..
T Consensus         3 ~~~G~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~---~~~~~T~~~~~t~nP~wne~f~f~v~~~~-~~L~i~V~d~~~~   78 (126)
T d2ep6a1           3 KDVGILQVKVLKAADLLAADFSGKSDPFCLLELG---NDRLQTHTVYKNLNPEWNKVFTFPIKDIH-DVLEVTVFDEDGD   78 (126)
T ss_dssp             CCSEEEEEEEEEEESCCCSSSSSCCCEEEEEEET---TEEEECCCCSSCSSCCCCEEEEEEESCTT-CEEEEEEEEEETT
T ss_pred             CccEEEEEEEEEeECCCCCCCCCCcCeEEEEEcC---CeEEEEEeeCCceeEEEEEEEEEEEeccC-ceeEEEEEEccCC
Confidence            5789999999999999999999999999999997   67899999999999999999999998654 6899999999998


Q ss_pred             CCCCceEEEEEEccccCCCceeEEEEEeeecccccCCCcceeEEEEEEEEe
Q 008214          339 QSSELIGCAQVRLCELEPGKVKDVWLKLVKDLDVQRDTKYRGQVHLELLYC  389 (573)
Q Consensus       339 ~~d~~lG~~~i~l~~l~~~~~~~~w~~L~~~~~~~~~~~~~G~i~l~l~~~  389 (573)
                      ++|++||++.++|.++..+.  ..|+.|...   ......+|+|++++++.
T Consensus        79 ~~d~~lG~~~i~l~~l~~~~--~~~~~l~~~---~~~~~~~G~i~l~~~~i  124 (126)
T d2ep6a1          79 KPPDFLGKVAIPLLSIRDGQ--PNCYVLKNK---DLEQAFKGVIYLEMDLI  124 (126)
T ss_dssp             EEEEECCBCEEEGGGCCSSC--CEECCCBCS---CTTSCCSSEEEEEEEEE
T ss_pred             cCcceEEEEEEEHHHCCCCC--ceEEEcccc---CCCCceeEEEEEEEEEE
Confidence            89999999999999997765  467776432   22456779999999885



>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure