Citrus Sinensis ID: 008267


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570--
MSSKINHHHQNDKTNGQIFPQPCPHLADFHARNGTKPFRAIQDCLHIKPPGGRAAIRRDSSEVPRCGVCGDSSCPRLYACMACAAVSCHVPPHSSHVAIHATKTSSACSHEIAVDVDRAELFCCACRDQVYDRDFDAAVVLAHTTSIIQSSKPENLRKRRRIDYRPWSPDLRERSLMVNNASPIDSMSSSNGDLPRGLRGLNNLGNTCFMNSVLQALFHTPPLRNYFLSDRHNRYYCQSKNGVRLCLACDLDTMFSAIFCGDRMPYSPAKFLYSWWRHASNLASYEQQDAHEFFISMLDGIHEKVEKDQHKPRSQGNGDCCIAHRVFSGILRSDVMCMACGFTSTTFDPCVDFSLDLEPNQGSSMKTSSTKSNHSCNCEADGMNSSQNCGISTLMGCLDRFTRPERLGSDQKFFCQQCQVRQESLKQMSIRKLPLVSCFHIKRFEHSSVRKMSRKVDRYLQFPLSLDMAPYLSSSILRSRFGNRFFPFDGDESNTLNEPSSEFELFAVVTHTGKLDAGHYVTYLRLSNKWYKCDDAWITEVNENTVRAAQGYMMFYVQKMLYYKASEKQGTS
cccccccccccccccccccccccccHHHHHHHccccccHHHHHHcccccccccccccccccccccccccccccccccEEEEEccccccccccccccHHHHHHHccccccccEEEEcccccEEEcccccCEccccHHHHHHHHcccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEECcEEEEcccccECccccccEEEEECcccccccccccccccccccccccccccccccccccccHHHHHHHcccccECccccccccccccccccEEEEEEccccccEEEEEEcccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccccccEEEEEEccccEEEECccEEEEEcHHHHcccccEEEEEEEEccccccccccccc
********************QPCPHLADFHARNGTKPFRAIQDCLHIKPPG***AI*****EVPRCGVCGDSSCPRLYACMACAAVSCHVPPHSSHVAIHATKTSSACSHEIAVDVDRAELFCCACRDQVYDRDFDAAVVLAHTTSII***************YR**********************SSSNGDLPRGLRGLNNLGNTCFMNSVLQALFHTPPLRNYFLSDRHNRYYCQSKNGVRLCLACDLDTMFSAIFCGDRMPYSPAKFLYSWWRHASNLASYEQQDAHEFFISMLDGIHEK************NGDCCIAHRVFSGILRSDVMCMACGFTSTTFDPCVDFSLDLE***************************SQNCGISTLMGCLDRFTRPERLGSDQKFFCQQCQVRQESLKQMSIRKLPLVSCFHIKRFEHSSVRKMSRKVDRYLQFPLSLDMAPYLSSSI********************NEPSSEFELFAVVTHTGKLDAGHYVTYLRLSNKWYKCDDAWITEVNENTVRAAQGYMMFYVQKMLYYK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKINHHHQNDKTNGQIFPQPCPHLADFHARNGTKPFRAIQDCLHIKPPGGRAAIRRDSSEVPRCGVCGDSSCPRLYACMACAAVSCHVPPHSSHVAIHATKTSSACSHEIAVDVDRAELFCCACRDQVYDRDFDAAVVLAHTTSIIQSSKPENLRKRRRIDYRPWSPDLRERSLMVNNASPIDSMSSSNGDLPRGLRGLNNLGNTCFMNSVLQALFHTPPLRNYFLSDRHNRYYCQSKNGVRLCLACDLDTMFSAIFCGDRMPYSPAKFLYSWWRHASNLASYEQQDAHEFFISMLDGIHEKVEKDQHKPRSQGNGDCCIAHRVFSGILRSDVMCMACGFTSTTFDPCVDFSLDLEPNQGSSMKTSSTKSNHSCNCEADGMNSSQNCGISTLMGCLDRFTRPERLGSDQKFFCQQCQVRQESLKQMSIRKLPLVSCFHIKRFEHSSVRKMSRKVDRYLQFPLSLDMAPYLSSSILRSRFGNRFFPFDGDESNTLNEPSSEFELFAVVTHTGKLDAGHYVTYLRLSNKWYKCDDAWITEVNENTVRAAQGYMMFYVQKMLYYKASEKQGTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 22 Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. Recruited to specific gene promoters by activators, where it is required for transcription.probableA6H8I0
Ubiquitin carboxyl-terminal hydrolase 22 Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. Recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation and cell cycle progression.probableQ9UPT9
Ubiquitin carboxyl-terminal hydrolase 22 Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. Recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation and cell cycle progression.probableQ5DU02

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 209-359,391-475,497-561
View the alignment between query and template
View the model in PyMOL
Template: 3IHP, chain A
Confidence level:very confident
Coverage over the Query: 63-151,192-308,321-560
View the alignment between query and template
View the model in PyMOL
Template: 3M99, chain A
Confidence level:confident
Coverage over the Query: 23-142,157-189,207-361,393-412,424-473,498-557
View the alignment between query and template
View the model in PyMOL