Citrus Sinensis ID: 008325


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570
MMNYFPDEVIEHVFDFVTSQKDRNAVSLVCKSWYKIERLSRQSVFIGNCYAISPERVIGRFPGLKSLTLKGKPHFADFNLLPYDWGGWVYPWVEALAKSRVGLEELRLKRMVVSDDCLELLSRSFVNFKSLVLVSCEGFTTDGLAAIAANCRYLRELDLQEIEVDDNRGQWISCFPDSCTSLVSLNFSCLKGEINLTALERLVARSPNLKSLRLNRAVPLDTLQKLLMRAPQLVDLGIGSFVYDPSSEAYIKLKATLVKCKSIRSLSGFLEVVPCCLSAIHPVCQNLTSLNLSYAPGIHGNELIKLIRFCRKLERLWILDSIGDRGLGVVAFTCKELQELRVFPSGVDNAAVTEEGLVAISAGCPKLHSLLYFCQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFGAIVQSCKRLRRLSLSGLLTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKKLRKLEIRDSPFGNTALLTDVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIINEDDQMEFSLDDRQKVGKMYLYRTLVGPRKDAPDFVWTL
ccccccHHHHHHHHHccccHHHHHHHHHHcHHHHHHHcccccEEEEcccccccHHHHHHccccccEEEcccccccccccccccccccccHHHHHHHHHHcccccEEEccccEEccHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccccEEEEECcccccccccHHHHHcccccccccEEEcccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHcccccEECcccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccEECccccccccHHHHHHHHHccccccEEEccccccHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHcccccEEEEcccccccHHHHHHHHHcccccccccEEccccccccccccccHHHHHHHHHHccccccEEEccccccHHHHHHHHHccccccEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccEEEEEcccccccccccccccccEEEEEEEccccccccccccccc
MMNYFPDEVIEHVFDFVTSQKDRNAVSLVCKSWYKIERLSRQSVFIGNCYAISPERVIGRFPGLKSLTLKGKPHFADFNLLPYDWGGWVYPWVEALAKSRVGLEELRLKRMVVSDDCLELLSRSFVNFKSLVLVSCEGFTTDGLAAIAANCRYLRELDLQEIEVDDNRGQWISCFPDSCTSLVSLNFSCLKGEINLTALERLVARSPNLKSLRLNRAVPLDTLQKLLMRAPQLVDLGIGSFVYDPSSEAYIKLKATLVKCKSIRSLSGFLEVVPCCLSAIHPVCQNLTSLNLSYAPGIHGNELIKLIRFCRKLERLWILDSIGDRGLGVVAFTCKELQELRVFPSGVDNAAVTEEGLVAISAGCPKLHSLLYFCQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFGAIVQSCKRLRRLSLSGLLTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKKLRKLEIRDSPFGNTALLTDVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIINEDDQMEFSLDDRQKVGKMYLYRTLVGPRKDAPDFVWTL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMNYFPDEVIEHVFDFVTSQKDRNAVSLVCKSWYKIERLSRQSVFIGNCYAISPERVIGRFPGLKSLTLKGKPHFADFNLLPYDWGGWVYPWVEALAKSRVGLEELRLKRMVVSDDCLELLSRSFVNFKSLVLVSCEGFTTDGLAAIAANCRYLRELDLQEIEVDDNRGQWISCFPDSCTSLVSLNFSCLKGEINLTALERLVARSPNLKSLRLNRAVPLDTLQKLLMRAPQLVDLGIGSFVYDPSSEAYIKLKATLVKCKSIRSLSGFLEVVPCCLSAIHPVCQNLTSLNLSYAPGIHGNELIKLIRFCRKLERLWILDSIGDRGLGVVAFTCKELQELRVFPSGVDNAAVTEEGLVAISAGCPKLHSLLYFCQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFGAIVQSCKRLRRLSLSGLLTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKKLRKLEIRDSPFGNTALLTDVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIINEDDQMEFSLDDRQKVGKMYLYRTLVGPRKDAPDFVWTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein AUXIN SIGNALING F-BOX 2 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Confers sensitivity to the virulent bacterial pathogen P.syringae (By similarity). Auxin receptor that mediates Aux/IAA proteins proteasomal degradation and auxin-regulated transcription. Involved in embryogenesis regulation by auxin.confidentQ9LW29
Transport inhibitor response 1-like protein Os04g0395600 probableQ7XVM8
Protein AUXIN SIGNALING F-BOX 3 Confers sensitivity to the virulent bacterial pathogen P.syringae (By similarity).Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Auxin receptor that mediates Aux/IAA proteins proteasomal degradation and auxin-regulated transcription. Involved in embryogenesis regulation by auxin.probableQ9LPW7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 6-570
View the alignment between query and template
View the model in PyMOL