Citrus Sinensis ID: 008332
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 570 | ||||||
| 356558668 | 909 | PREDICTED: uncharacterized protein LOC10 | 0.891 | 0.558 | 0.520 | 1e-144 | |
| 224142425 | 763 | predicted protein [Populus trichocarpa] | 0.924 | 0.690 | 0.529 | 1e-144 | |
| 359484771 | 781 | PREDICTED: G-type lectin S-receptor-like | 0.884 | 0.645 | 0.498 | 1e-134 | |
| 359497026 | 738 | PREDICTED: G-type lectin S-receptor-like | 0.896 | 0.692 | 0.460 | 1e-125 | |
| 296088199 | 1130 | unnamed protein product [Vitis vinifera] | 0.864 | 0.436 | 0.435 | 1e-116 | |
| 255565055 | 721 | conserved hypothetical protein [Ricinus | 0.850 | 0.672 | 0.442 | 1e-107 | |
| 5814093 | 739 | receptor-like kinase CHRK1 [Nicotiana ta | 0.849 | 0.654 | 0.405 | 1e-101 | |
| 147787796 | 658 | hypothetical protein VITISV_036051 [Viti | 0.796 | 0.689 | 0.405 | 7e-98 | |
| 296084604 | 580 | unnamed protein product [Vitis vinifera] | 0.577 | 0.567 | 0.516 | 1e-91 | |
| 255565053 | 445 | conserved hypothetical protein [Ricinus | 0.628 | 0.804 | 0.460 | 2e-85 |
| >gi|356558668|ref|XP_003547625.1| PREDICTED: uncharacterized protein LOC100787480 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 520 bits (1338), Expect = e-144, Method: Compositional matrix adjust.
Identities = 288/553 (52%), Positives = 367/553 (66%), Gaps = 45/553 (8%)
Query: 5 IISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQ 64
I ++F LL E P KA+ W++ GY +S IN L+THLIC+ A++NS+TY+
Sbjct: 7 IALVLFEFLLCQEFEPLKAQTWLQAGYWYSGSGFPVSDINSALYTHLICAFAELNSSTYE 66
Query: 65 LSLSLPSDENQIAKFADTVKKKNPSITTILSI--GQGKDTNYSIYSSMVRNSSHRKSFID 122
L +S P DE + F TVK+KNPSITT+LSI G G DT + S MV S RK FI
Sbjct: 67 LYVS-PEDEQSFSSFTTTVKQKNPSITTLLSIAGGNGNDT---VLSLMVSKDSSRKYFIQ 122
Query: 123 SSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTA 182
SSIRIARLYGF+GLD +W P T +DM N+G LF+EWR AA A +ST+ +LILTA
Sbjct: 123 SSIRIARLYGFQGLDLSWV-PETISDMNNMGRLFEEWRAAAKSEAANDSTQ---VLILTA 178
Query: 183 RFRYSPPANS--YLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTD 240
+ P +S Y + SIQ NLNW+H +T Y+ P NFTA AALY S + +TD
Sbjct: 179 AVHFRPGLDSASYPVESIQNNLNWVHILTYDYHMPQLANFTAAHAALYDPSS---SVNTD 235
Query: 241 QVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNH 300
+K WI G++A KLV+ LPFYGYAW L PEDN IGA+A GPA+ SG + YK IK +
Sbjct: 236 NGIKEWIGSGVTASKLVLGLPFYGYAWNLRNPEDNAIGASATGPAIGKSGAMNYKDIKAY 295
Query: 301 IKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDD 360
I+ YG V+ YN+TY VNYFS G+ W G+DDVE V+ K++YA+E +LLGY WQV +DD
Sbjct: 296 IQRYGGHVK--YNATYVVNYFSNGSTWIGYDDVEVVKMKVSYARENKLLGYAVWQVPYDD 353
Query: 361 HDWLLSQAAAQKDSITSASVDKDEHSSNRRLSIALISTAAAALTLLLGCCAYKYNQMKRL 420
+W+LS AAA+ VD++ +S R L I LI TA + + LLG Y ++R
Sbjct: 354 -NWVLSSAAAEH-------VDQNGRNSWRLLVIILIITAMSVI--LLGILIY---YLRR- 399
Query: 421 NLIEEDSAKASNTRANNETEAGD-FNRNVPNLRVYSLADIEAATERFSIRNKLGEGGYGP 479
R T+A F+ N P+L+V+S +DIE AT RFSI NK+G+GGYGP
Sbjct: 400 -------------RFPKSTDASRLFHSNAPDLQVFSFSDIEQATNRFSIENKVGQGGYGP 446
Query: 480 VYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIY 539
VYKG+L + +AVKKLSK STQGFEEFKNEVMLTA+LQHVNL+R+LGF ID E++ML+Y
Sbjct: 447 VYKGILSNRQEVAVKKLSKASTQGFEEFKNEVMLTARLQHVNLVRLLGFYIDGEQQMLVY 506
Query: 540 EYMPNKSLDCYLF 552
EYMPNKSLD YLF
Sbjct: 507 EYMPNKSLDSYLF 519
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224142425|ref|XP_002324558.1| predicted protein [Populus trichocarpa] gi|222865992|gb|EEF03123.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359484771|ref|XP_003633158.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RKS1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359497026|ref|XP_003635401.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296088199|emb|CBI35714.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255565055|ref|XP_002523520.1| conserved hypothetical protein [Ricinus communis] gi|223537227|gb|EEF38859.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|5814093|gb|AAD52097.1|AF088885_1 receptor-like kinase CHRK1 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|147787796|emb|CAN60684.1| hypothetical protein VITISV_036051 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296084604|emb|CBI25625.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255565053|ref|XP_002523519.1| conserved hypothetical protein [Ricinus communis] gi|223537226|gb|EEF38858.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 570 | ||||||
| TAIR|locus:2134025 | 379 | ChiC "class V chitinase" [Arab | 0.640 | 0.963 | 0.368 | 7.1e-61 | |
| TAIR|locus:2134030 | 366 | AT4G19820 [Arabidopsis thalian | 0.624 | 0.972 | 0.352 | 7.5e-57 | |
| TAIR|locus:2133955 | 369 | AT4G19760 [Arabidopsis thalian | 0.575 | 0.888 | 0.384 | 1.6e-56 | |
| TAIR|locus:2133940 | 362 | AT4G19750 [Arabidopsis thalian | 0.549 | 0.864 | 0.395 | 6.8e-56 | |
| TAIR|locus:2134015 | 398 | AT4G19800 [Arabidopsis thalian | 0.550 | 0.788 | 0.365 | 1.8e-55 | |
| TAIR|locus:2134010 | 363 | AT4G19720 [Arabidopsis thalian | 0.596 | 0.936 | 0.359 | 2e-49 | |
| TAIR|locus:2134020 | 332 | AT4G19730 [Arabidopsis thalian | 0.559 | 0.960 | 0.345 | 1e-43 | |
| TAIR|locus:2133970 | 261 | AT4G19770 [Arabidopsis thalian | 0.443 | 0.969 | 0.384 | 6.6e-42 | |
| UNIPROTKB|O49974 | 848 | KIK1 "Serine/threonine-protein | 0.189 | 0.127 | 0.638 | 1.1e-29 | |
| TAIR|locus:2131684 | 783 | AT4G27290 [Arabidopsis thalian | 0.228 | 0.166 | 0.514 | 1.5e-29 |
| TAIR|locus:2134025 ChiC "class V chitinase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 623 (224.4 bits), Expect = 7.1e-61, P = 7.1e-61
Identities = 139/377 (36%), Positives = 219/377 (58%)
Query: 5 IISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQ 64
+IS+I + L + A+ ++ Y + ++ I+ LFTHL C+ AD+NS T Q
Sbjct: 6 LISLIVSITFFLTLQCSMAQTVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQ 65
Query: 65 LSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSS 124
+++S +++ + + F TV+++NPS+ T+LSIG G + + Y+SM N + RKSFIDSS
Sbjct: 66 VTVS-SANQPKFSTFTQTVQRRNPSVKTLLSIGGGI-ADKTAYASMASNPTSRKSFIDSS 123
Query: 125 IRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARF 184
IR+AR YGF GLD W P+++T+M N G L EWR +A +A +S + + LL+ A F
Sbjct: 124 IRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWR-SAVVAEASSSGKPR-LLLAAAVF 181
Query: 185 RYSPPANS--YLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQV 242
YS S Y ++++ +L+W++ + +Y P + T PPAAL+ + S D
Sbjct: 182 -YSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNA--GPSGDAG 238
Query: 243 LKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIK 302
++WI+ GL A K V+ P+YGYAW L + A G A+ G + Y +I+ I
Sbjct: 239 TRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIV 298
Query: 303 TYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHD 362
G +YNST +Y GT W G+DD +++ K+ YAK++ LLGY++W V DD+
Sbjct: 299 DNG--ATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNS 356
Query: 363 WLLSQAAAQKDSITSAS 379
L S+AA+Q T+A+
Sbjct: 357 GL-SRAASQAWDATTAT 372
|
|
| TAIR|locus:2134030 AT4G19820 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133955 AT4G19760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133940 AT4G19750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2134015 AT4G19800 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2134010 AT4G19720 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2134020 AT4G19730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133970 AT4G19770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O49974 KIK1 "Serine/threonine-protein kinase" [Zea mays (taxid:4577)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131684 AT4G27290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 570 | |||
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 5e-94 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 2e-63 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 3e-58 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 2e-40 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 7e-23 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 5e-18 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 5e-18 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 2e-17 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 4e-17 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 4e-16 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 9e-16 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 6e-14 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 1e-13 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 2e-13 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 2e-12 | |
| cd05048 | 283 | cd05048, PTKc_Ror, Catalytic Domain of the Protein | 4e-12 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 3e-11 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 4e-11 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 4e-11 | |
| cd05049 | 280 | cd05049, PTKc_Trk, Catalytic domain of the Protein | 1e-10 | |
| cd05044 | 269 | cd05044, PTKc_c-ros, Catalytic domain of the Prote | 2e-10 | |
| cd05052 | 263 | cd05052, PTKc_Abl, Catalytic domain of the Protein | 1e-09 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 2e-09 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 8e-09 | |
| cd06631 | 265 | cd06631, STKc_YSK4, Catalytic domain of the Protei | 2e-08 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 4e-08 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 4e-08 | |
| cd05092 | 280 | cd05092, PTKc_TrkA, Catalytic domain of the Protei | 5e-08 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 6e-08 | |
| cd05081 | 284 | cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) | 7e-08 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 7e-08 | |
| cd05035 | 273 | cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li | 8e-08 | |
| cd05050 | 288 | cd05050, PTKc_Musk, Catalytic domain of the Protei | 8e-08 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 2e-07 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 2e-07 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 3e-07 | |
| cd05094 | 291 | cd05094, PTKc_TrkC, Catalytic domain of the Protei | 3e-07 | |
| cd05091 | 283 | cd05091, PTKc_Ror2, Catalytic domain of the Protei | 3e-07 | |
| cd05093 | 288 | cd05093, PTKc_TrkB, Catalytic domain of the Protei | 3e-07 | |
| cd05097 | 295 | cd05097, PTKc_DDR_like, Catalytic domain of Discoi | 4e-07 | |
| cd05110 | 303 | cd05110, PTKc_HER4, Catalytic domain of the Protei | 4e-07 | |
| cd05051 | 296 | cd05051, PTKc_DDR, Catalytic domain of the Protein | 4e-07 | |
| cd05036 | 277 | cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro | 1e-06 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 2e-06 | |
| cd06632 | 258 | cd06632, STKc_MEKK1_plant, Catalytic domain of the | 3e-06 | |
| cd06613 | 262 | cd06613, STKc_MAP4K3_like, Catalytic domain of Mit | 3e-06 | |
| cd05112 | 256 | cd05112, PTKc_Itk, Catalytic domain of the Protein | 3e-06 | |
| cd05046 | 275 | cd05046, PTK_CCK4, Pseudokinase domain of the Prot | 6e-06 | |
| cd05096 | 304 | cd05096, PTKc_DDR1, Catalytic domain of the Protei | 6e-06 | |
| cd05095 | 296 | cd05095, PTKc_DDR2, Catalytic domain of the Protei | 7e-06 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 8e-06 | |
| cd05063 | 268 | cd05063, PTKc_EphR_A2, Catalytic domain of the Pro | 1e-05 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 1e-05 | |
| cd05040 | 257 | cd05040, PTKc_Ack_like, Catalytic domain of the Pr | 2e-05 | |
| cd06612 | 256 | cd06612, STKc_MST1_2, Catalytic domain of the Prot | 2e-05 | |
| cd05060 | 257 | cd05060, PTKc_Syk_like, Catalytic domain of Spleen | 2e-05 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 3e-05 | |
| cd05056 | 270 | cd05056, PTKc_FAK, Catalytic domain of the Protein | 3e-05 | |
| cd05045 | 290 | cd05045, PTKc_RET, Catalytic domain of the Protein | 4e-05 | |
| cd07836 | 284 | cd07836, STKc_Pho85, Catalytic domain of the Serin | 4e-05 | |
| cd05080 | 283 | cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma | 4e-05 | |
| cd05090 | 283 | cd05090, PTKc_Ror1, Catalytic domain of the Protei | 4e-05 | |
| cd05067 | 260 | cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro | 5e-05 | |
| cd05108 | 316 | cd05108, PTKc_EGFR, Catalytic domain of the Protei | 6e-05 | |
| cd08529 | 256 | cd08529, STKc_FA2-like, Catalytic domain of the Pr | 6e-05 | |
| cd05065 | 269 | cd05065, PTKc_EphR_B, Catalytic domain of the Prot | 6e-05 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 1e-04 | |
| cd05059 | 256 | cd05059, PTKc_Tec_like, Catalytic domain of Tec-li | 1e-04 | |
| cd07860 | 284 | cd07860, STKc_CDK2_3, Catalytic domain of the Seri | 1e-04 | |
| cd06626 | 264 | cd06626, STKc_MEKK4, Catalytic domain of the Prote | 1e-04 | |
| cd05111 | 279 | cd05111, PTK_HER3, Pseudokinase domain of the Prot | 1e-04 | |
| cd05066 | 267 | cd05066, PTKc_EphR_A, Catalytic domain of the Prot | 2e-04 | |
| cd05037 | 259 | cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom | 2e-04 | |
| cd05070 | 260 | cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro | 3e-04 | |
| cd05071 | 262 | cd05071, PTKc_Src, Catalytic domain of the Protein | 3e-04 | |
| cd07842 | 316 | cd07842, STKc_CDK8_like, Catalytic domain of Cycli | 3e-04 | |
| cd08530 | 256 | cd08530, STKc_CNK2-like, Catalytic domain of the P | 3e-04 | |
| cd07841 | 298 | cd07841, STKc_CDK7, Catalytic domain of the Serine | 3e-04 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 3e-04 | |
| cd06624 | 268 | cd06624, STKc_ASK, Catalytic domain of the Protein | 3e-04 | |
| cd08224 | 267 | cd08224, STKc_Nek6_Nek7, Catalytic domain of the P | 4e-04 | |
| cd05042 | 269 | cd05042, PTKc_Aatyk, Catalytic domain of the Prote | 4e-04 | |
| cd05075 | 272 | cd05075, PTKc_Axl, Catalytic domain of the Protein | 4e-04 | |
| cd06628 | 267 | cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o | 5e-04 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 6e-04 | |
| cd06545 | 253 | cd06545, GH18_3CO4_chitinase, The Bacteroides thet | 6e-04 | |
| cd05078 | 258 | cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat | 8e-04 | |
| cd07852 | 337 | cd07852, STKc_MAPK15, Catalytic domain of the Seri | 9e-04 | |
| cd05085 | 250 | cd05085, PTKc_Fer, Catalytic domain of the Protein | 0.001 | |
| cd05032 | 277 | cd05032, PTKc_InsR_like, Catalytic domain of Insul | 0.001 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 0.001 | |
| cd07866 | 311 | cd07866, STKc_BUR1, Catalytic domain of the Serine | 0.001 | |
| cd05062 | 277 | cd05062, PTKc_IGF-1R, Catalytic domain of the Prot | 0.001 | |
| cd05058 | 262 | cd05058, PTKc_Met_Ron, Catalytic domain of the Pro | 0.001 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 0.001 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 0.001 | |
| cd07839 | 284 | cd07839, STKc_CDK5, Catalytic domain of the Serine | 0.001 | |
| cd05079 | 284 | cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma | 0.002 | |
| cd05061 | 288 | cd05061, PTKc_InsR, Catalytic domain of the Protei | 0.002 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 0.002 | |
| cd06629 | 272 | cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o | 0.003 | |
| cd07864 | 302 | cd07864, STKc_CDK12, Catalytic domain of the Serin | 0.003 | |
| cd06646 | 267 | cd06646, STKc_MAP4K5, Catalytic domain of the Prot | 0.004 |
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
Score = 289 bits (741), Expect = 5e-94
Identities = 133/348 (38%), Positives = 197/348 (56%), Gaps = 57/348 (16%)
Query: 25 PWIRVGY-LNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTV 83
++ GY SE S I+ LFTHL + AD++ +TY++ +S PSDE++ + F +TV
Sbjct: 2 TIVKGGYWPAWSEEFPPSNIDSSLFTHLFYAFADLDPSTYEVVIS-PSDESEFSTFTETV 60
Query: 84 KKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAP 143
K+KNPS+ T+LSIG G ++ S +++M + + RK+FI+SSI++AR YGF GLD W P
Sbjct: 61 KRKNPSVKTLLSIG-GGGSDSSAFAAMASDPTARKAFINSSIKVARKYGFDGLDLDWEFP 119
Query: 144 NTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSP------PANSYLLNS 197
++ +M N G L +EWR AA K +A++S R L+LTA +SP + SY + +
Sbjct: 120 SSQVEMENFGKLLEEWR-AAVKDEARSSGRPP--LLLTAAVYFSPILFLSDDSVSYPIEA 176
Query: 198 IQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLV 257
I +NL+W++ + YY +N T P AALY S STD +K+WI+ G+ A KLV
Sbjct: 177 INKNLDWVNVMAYDYYGSWESNTTGPAAALYDPNSN---VSTDYGIKSWIKAGVPAKKLV 233
Query: 258 MCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYE 317
+ LP YG AWTL Y++T
Sbjct: 234 LGLPLYGRAWTL------------------------------------------YDTTTV 251
Query: 318 VNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLL 365
+Y GT W G+DDV+++ K+ YAK+K LLGY+AW V +DD++WL
Sbjct: 252 SSYVYAGTTWIGYDDVQSIAVKVKYAKQKGLLGYFAWAVGYDDNNWLS 299
|
The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity. Length = 299 |
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 570 | |||
| cd02879 | 299 | GH18_plant_chitinase_class_V The class V plant chi | 100.0 | |
| cd02873 | 413 | GH18_IDGF The IDGF's (imaginal disc growth factors | 100.0 | |
| cd02872 | 362 | GH18_chitolectin_chitotriosidase This conserved do | 100.0 | |
| KOG2806 | 432 | consensus Chitinase [Carbohydrate transport and me | 100.0 | |
| COG3325 | 441 | ChiA Chitinase [Carbohydrate transport and metabol | 100.0 | |
| cd02878 | 345 | GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin | 100.0 | |
| smart00636 | 334 | Glyco_18 Glycosyl hydrolase family 18. | 100.0 | |
| cd06548 | 322 | GH18_chitinase The GH18 (glycosyl hydrolases, fami | 100.0 | |
| PF00704 | 343 | Glyco_hydro_18: Glycosyl hydrolases family 18; Int | 100.0 | |
| cd02876 | 318 | GH18_SI-CLP Stabilin-1 interacting chitinase-like | 100.0 | |
| cd02875 | 358 | GH18_chitobiase Chitobiase (also known as di-N-ace | 100.0 | |
| cd02874 | 313 | GH18_CFLE_spore_hydrolase Cortical fragment-lytic | 100.0 | |
| cd06545 | 253 | GH18_3CO4_chitinase The Bacteroides thetaiotaomicr | 100.0 | |
| cd06549 | 298 | GH18_trifunctional GH18 domain of an uncharacteriz | 100.0 | |
| cd00598 | 210 | GH18_chitinase-like The GH18 (glycosyl hydrolase, | 100.0 | |
| cd06544 | 253 | GH18_narbonin Narbonin is a plant 2S protein from | 100.0 | |
| cd06546 | 256 | GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase | 100.0 | |
| COG3858 | 423 | Predicted glycosyl hydrolase [General function pre | 100.0 | |
| cd02871 | 312 | GH18_chitinase_D-like GH18 domain of Chitinase D ( | 99.97 | |
| KOG2091 | 392 | consensus Predicted member of glycosyl hydrolase f | 99.92 | |
| cd06542 | 255 | GH18_EndoS-like Endo-beta-N-acetylglucosaminidases | 99.91 | |
| cd02877 | 280 | GH18_hevamine_XipI_class_III This conserved domain | 99.86 | |
| cd06543 | 294 | GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch | 99.85 | |
| COG3469 | 332 | Chitinase [Carbohydrate transport and metabolism] | 99.77 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 99.75 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 99.73 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 99.7 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 99.66 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 99.56 | |
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 99.56 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 99.54 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 99.5 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 99.48 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 99.46 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 99.45 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 99.36 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 99.36 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.29 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 99.25 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 99.24 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 99.24 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 99.23 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 99.22 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 99.19 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 99.16 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.13 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.11 | |
| KOG0659 | 318 | consensus Cdk activating kinase (CAK)/RNA polymera | 99.1 | |
| KOG1024 | 563 | consensus Receptor-like protein tyrosine kinase RY | 99.1 | |
| KOG4701 | 568 | consensus Chitinase [Cell wall/membrane/envelope b | 99.09 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 99.08 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 99.08 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.08 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 99.08 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 99.07 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 99.05 | |
| KOG0597 | 808 | consensus Serine-threonine protein kinase FUSED [G | 99.05 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.05 | |
| KOG0593 | 396 | consensus Predicted protein kinase KKIAMRE [Genera | 99.04 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.04 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 99.04 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.04 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 99.03 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 99.03 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.02 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 99.02 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 99.01 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 99.0 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 99.0 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 99.0 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 99.0 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 98.99 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 98.99 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 98.99 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 98.98 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 98.98 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 98.98 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 98.98 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 98.97 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 98.97 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 98.97 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 98.96 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 98.96 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 98.96 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 98.96 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 98.96 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 98.96 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 98.95 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 98.95 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 98.95 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 98.95 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 98.95 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 98.95 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 98.95 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 98.94 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 98.94 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 98.94 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 98.94 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 98.94 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 98.94 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 98.94 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 98.93 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 98.93 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 98.93 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 98.93 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 98.93 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 98.92 | |
| KOG0610 | 459 | consensus Putative serine/threonine protein kinase | 98.92 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 98.92 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 98.92 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 98.92 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 98.91 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 98.91 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 98.91 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 98.9 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 98.9 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 98.9 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 98.9 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 98.9 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 98.9 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 98.9 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 98.89 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 98.89 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 98.89 | |
| KOG0586 | 596 | consensus Serine/threonine protein kinase [General | 98.89 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 98.89 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 98.89 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 98.89 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 98.89 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 98.89 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 98.88 | |
| KOG0616 | 355 | consensus cAMP-dependent protein kinase catalytic | 98.88 | |
| KOG0589 | 426 | consensus Serine/threonine protein kinase [General | 98.88 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 98.88 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 98.88 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 98.88 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 98.88 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 98.88 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 98.88 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 98.88 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 98.87 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 98.87 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 98.87 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 98.87 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 98.87 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 98.87 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 98.87 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 98.86 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 98.86 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 98.86 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 98.86 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 98.86 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 98.86 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 98.86 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 98.86 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 98.86 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 98.86 | |
| KOG0588 | 786 | consensus Serine/threonine protein kinase [Cell cy | 98.86 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 98.86 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 98.86 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 98.86 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 98.85 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 98.85 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 98.85 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 98.85 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 98.85 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 98.85 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 98.85 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 98.84 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 98.84 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 98.84 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 98.84 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 98.84 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 98.83 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 98.83 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 98.82 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 98.82 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 98.82 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 98.82 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 98.82 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 98.82 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 98.82 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 98.82 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 98.82 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 98.82 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 98.82 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 98.82 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 98.81 | |
| KOG0200 | 609 | consensus Fibroblast/platelet-derived growth facto | 98.81 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 98.81 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 98.81 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 98.81 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 98.81 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 98.81 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 98.81 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 98.81 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 98.81 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 98.81 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 98.81 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 98.81 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 98.81 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 98.81 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 98.81 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 98.8 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 98.8 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 98.8 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 98.8 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 98.8 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 98.8 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 98.79 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 98.79 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 98.79 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 98.79 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 98.79 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 98.79 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 98.79 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 98.79 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 98.79 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 98.79 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 98.79 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 98.78 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 98.78 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 98.78 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 98.78 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 98.78 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 98.78 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 98.78 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 98.78 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 98.78 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 98.78 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 98.78 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 98.78 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 98.78 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 98.77 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 98.77 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 98.77 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 98.77 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 98.77 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 98.77 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 98.77 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 98.77 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 98.76 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 98.76 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 98.76 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 98.76 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 98.76 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 98.75 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 98.75 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 98.75 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 98.75 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 98.75 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 98.75 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 98.75 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 98.75 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 98.75 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 98.75 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 98.75 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 98.74 | |
| KOG0662 | 292 | consensus Cyclin-dependent kinase CDK5 [Intracellu | 98.74 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 98.74 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 98.74 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 98.74 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 98.74 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 98.74 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 98.74 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 98.74 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 98.74 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 98.74 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 98.74 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 98.73 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 98.73 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 98.73 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 98.73 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 98.72 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 98.72 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 98.72 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 98.72 | |
| KOG0585 | 576 | consensus Ca2+/calmodulin-dependent protein kinase | 98.72 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 98.72 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 98.71 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 98.71 | |
| KOG4717 | 864 | consensus Serine/threonine protein kinase [Signal | 98.71 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 98.7 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 98.7 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 98.7 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 98.7 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 98.69 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 98.69 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 98.69 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 98.69 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 98.69 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 98.68 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 98.68 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 98.68 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 98.68 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 98.67 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 98.67 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 98.67 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 98.67 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 98.66 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 98.66 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 98.66 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 98.66 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 98.66 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 98.66 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 98.65 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 98.65 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 98.65 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 98.65 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 98.65 | |
| KOG0592 | 604 | consensus 3-phosphoinositide-dependent protein kin | 98.64 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 98.64 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 98.64 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 98.64 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 98.64 | |
| KOG0607 | 463 | consensus MAP kinase-interacting kinase and relate | 98.64 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 98.64 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 98.64 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 98.64 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 98.64 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 98.63 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 98.63 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 98.62 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 98.62 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 98.61 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 98.61 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 98.61 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 98.6 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 98.6 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 98.6 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 98.59 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 98.59 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 98.59 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 98.59 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 98.57 | |
| KOG0033 | 355 | consensus Ca2+/calmodulin-dependent protein kinase | 98.57 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 98.57 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 98.57 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 98.57 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 98.57 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 98.57 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 98.56 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 98.55 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.55 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 98.55 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 98.54 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 98.52 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 98.51 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 98.51 | |
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 98.5 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 98.5 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 98.5 | |
| KOG0587 | 953 | consensus Traf2- and Nck-interacting kinase and re | 98.49 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 98.49 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 98.48 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 98.48 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 98.47 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 98.47 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 98.46 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 98.46 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 98.46 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 98.46 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 98.45 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 98.45 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 98.44 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 98.43 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 98.43 | |
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 98.41 | |
| cd06547 | 339 | GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG | 98.41 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 98.41 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 98.41 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 98.4 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 98.4 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 98.4 | |
| PRK10345 | 210 | hypothetical protein; Provisional | 98.4 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 98.4 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 98.39 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 98.39 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 98.39 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 98.37 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 98.36 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 98.35 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 98.35 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 98.35 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 98.35 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 98.34 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 98.34 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 98.34 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 98.34 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 98.29 | |
| KOG0576 | 829 | consensus Mitogen-activated protein kinase kinase | 98.27 | |
| KOG0584 | 632 | consensus Serine/threonine protein kinase [General | 98.27 | |
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 98.25 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 98.25 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 98.23 | |
| KOG4645 | 1509 | consensus MAPKKK (MAP kinase kinase kinase) SSK2 a | 98.23 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 98.22 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 98.22 | |
| cd05147 | 190 | RIO1_euk RIO kinase family; eukaryotic RIO1, catal | 98.2 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 98.19 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 98.18 | |
| PTZ00284 | 467 | protein kinase; Provisional | 98.17 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 98.13 | |
| KOG0666 | 438 | consensus Cyclin C-dependent kinase CDK8 [Transcri | 98.13 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 98.12 | |
| PRK14879 | 211 | serine/threonine protein kinase; Provisional | 98.09 | |
| KOG0599 | 411 | consensus Phosphorylase kinase gamma subunit [Carb | 98.06 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 98.06 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 98.05 | |
| KOG0608 | 1034 | consensus Warts/lats-like serine threonine kinases | 98.04 | |
| TIGR03724 | 199 | arch_bud32 Kae1-associated kinase Bud32. Members o | 98.02 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 98.0 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 98.0 | |
| KOG0669 | 376 | consensus Cyclin T-dependent kinase CDK9 [Cell cyc | 98.0 | |
| KOG0596 | 677 | consensus Dual specificity; serine/threonine and t | 97.95 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 97.94 | |
| cd05145 | 190 | RIO1_like RIO kinase family; RIO1, RIO3 and simila | 97.92 | |
| KOG1152 | 772 | consensus Signal transduction serine/threonine kin | 97.87 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 97.86 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 97.84 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 97.83 | |
| PF03644 | 311 | Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int | 97.77 | |
| KOG0695 | 593 | consensus Serine/threonine protein kinase [Signal | 97.76 | |
| KOG0668 | 338 | consensus Casein kinase II, alpha subunit [Signal | 97.68 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 97.63 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 97.6 | |
| KOG0604 | 400 | consensus MAP kinase-activated protein kinase 2 [S | 97.56 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 97.54 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 97.45 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 97.42 | |
| KOG0671 | 415 | consensus LAMMER dual specificity kinases [Signal | 97.42 | |
| smart00090 | 237 | RIO RIO-like kinase. | 97.4 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 97.37 | |
| KOG1290 | 590 | consensus Serine/threonine protein kinase [Signal | 97.35 | |
| cd05120 | 155 | APH_ChoK_like Aminoglycoside 3'-phosphotransferase | 97.3 | |
| KOG0984 | 282 | consensus Mitogen-activated protein kinase (MAPK) | 97.21 | |
| KOG1163 | 341 | consensus Casein kinase (serine/threonine/tyrosine | 97.16 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 97.15 | |
| KOG1345 | 378 | consensus Serine/threonine kinase [Signal transduc | 97.13 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 97.05 | |
| KOG0664 | 449 | consensus Nemo-like MAPK-related serine/threonine | 97.01 | |
| PRK12274 | 218 | serine/threonine protein kinase; Provisional | 96.93 | |
| PF11340 | 181 | DUF3142: Protein of unknown function (DUF3142); In | 96.88 | |
| KOG1164 | 322 | consensus Casein kinase (serine/threonine/tyrosine | 96.73 | |
| COG0515 | 384 | SPS1 Serine/threonine protein kinase [General func | 96.73 | |
| KOG0983 | 391 | consensus Mitogen-activated protein kinase (MAPK) | 96.69 | |
| cd05119 | 187 | RIO RIO kinase family, catalytic domain. The RIO k | 96.64 | |
| KOG1165 | 449 | consensus Casein kinase (serine/threonine/tyrosine | 96.62 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 96.59 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 96.54 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 96.29 | |
| PRK01723 | 239 | 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | 96.07 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 95.74 | |
| KOG0670 | 752 | consensus U4/U6-associated splicing factor PRP4 [R | 95.72 | |
| cd05154 | 223 | ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an | 95.49 | |
| PF08693 | 40 | SKG6: Transmembrane alpha-helix domain; InterPro: | 94.86 | |
| KOG2331 | 526 | consensus Predicted glycosylhydrolase [General fun | 94.81 | |
| cd05151 | 170 | ChoK Choline Kinase (ChoK). The ChoK subfamily is | 94.7 | |
| COG2112 | 201 | Predicted Ser/Thr protein kinase [Signal transduct | 94.56 | |
| KOG0665 | 369 | consensus Jun-N-terminal kinase (JNK) [Signal tran | 93.83 | |
| PF15102 | 146 | TMEM154: TMEM154 protein family | 90.96 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 90.66 | |
| PF04478 | 154 | Mid2: Mid2 like cell wall stress sensor; InterPro: | 88.85 | |
| COG0661 | 517 | AarF Predicted unusual protein kinase [General fun | 88.1 | |
| PF14883 | 294 | GHL13: Hypothetical glycosyl hydrolase family 13 | 87.78 | |
| KOG1243 | 690 | consensus Protein kinase [General function predict | 85.53 | |
| PF01102 | 122 | Glycophorin_A: Glycophorin A; InterPro: IPR001195 | 85.19 | |
| KOG3741 | 655 | consensus Poly(A) ribonuclease subunit [RNA proces | 84.09 | |
| PRK10593 | 297 | hypothetical protein; Provisional | 83.11 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 82.14 | |
| PF13095 | 207 | FTA2: Kinetochore Sim4 complex subunit FTA2 | 80.92 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 80.52 | |
| COG3642 | 204 | Mn2+-dependent serine/threonine protein kinase [Si | 80.32 | |
| PF02439 | 38 | Adeno_E3_CR2: Adenovirus E3 region protein CR2; In | 80.28 | |
| PRK09550 | 401 | mtnK methylthioribose kinase; Reviewed | 80.18 |
| >cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-64 Score=497.63 Aligned_cols=288 Identities=43% Similarity=0.810 Sum_probs=252.0
Q ss_pred eEEEEEecCCC-CCcCCCCCCCCcceEEEEeEEEeCCceEEeeCCCccHHHHHHHHHHHHhhCCCceEEEEEcCCCCCCc
Q 008332 26 WIRVGYLNLSE-VSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNY 104 (570)
Q Consensus 26 ~~vvgY~~~~~-~~~~~~i~~~~~Thii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lk~~~~~~kvllsigg~~~~~~ 104 (570)
-+++|||++|+ .+++++||+++||||+|+|+.++++++.+...+ .++..+..+.+.+|+++|++|+++|||||+. ++
T Consensus 3 ~~~~~Y~~~w~~~~~~~~i~~~~~THi~yaf~~~~~~~~~~~~~~-~~~~~~~~~~~~~k~~~~~lkvlisiGG~~~-~s 80 (299)
T cd02879 3 IVKGGYWPAWSEEFPPSNIDSSLFTHLFYAFADLDPSTYEVVISP-SDESEFSTFTETVKRKNPSVKTLLSIGGGGS-DS 80 (299)
T ss_pred eEEEEEECCCCCCCChhHCCcccCCEEEEEEEEecCCCCEEeecc-ccHHHHHHHHHHHHHhCCCCeEEEEEeCCCC-CC
Confidence 57899999998 899999999999999999999999877776654 3455677888889999999999999999875 46
Q ss_pred ccccccccChHHHHHHHHHHHHHHHHcCCCceeeeccCCCCCCCccchhhhHHHHHHHHhhhhhcccccccceEEEEeec
Q 008332 105 SIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARF 184 (570)
Q Consensus 105 ~~f~~~~~~~~~r~~fi~siv~~~~~~~~DGidiDwE~p~~~~~~~~~~~l~~~lr~~l~~~~~~~~~~~~~~~~~~~~~ 184 (570)
..|+.+++++++|++||+++++++++|+|||||||||||..++|+.+|+.|+++||++|+......+ +..+++++++
T Consensus 81 ~~fs~~~~~~~~R~~fi~siv~~l~~~~fDGidiDWE~P~~~~d~~n~~~ll~elr~~l~~~~~~~~---~~~~~ls~av 157 (299)
T cd02879 81 SAFAAMASDPTARKAFINSSIKVARKYGFDGLDLDWEFPSSQVEMENFGKLLEEWRAAVKDEARSSG---RPPLLLTAAV 157 (299)
T ss_pred chhhHHhCCHHHHHHHHHHHHHHHHHhCCCceeecccCCCChhHHHHHHHHHHHHHHHHHHHhhccC---CCcEEEEeec
Confidence 7899999999999999999999999999999999999998788999999999999999985322211 2345666666
Q ss_pred ccCC------CCCccChHHHhhhhceeeeecccCCCCCCCCCCCCCCCCCCCCCCCCccCHHHHHHHHHHcCCCCCceee
Q 008332 185 RYSP------PANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVM 258 (570)
Q Consensus 185 ~~~~------~~~~~~~~~l~~~vD~i~vm~yd~~~~~~~~~~~~~a~l~~~~~~~~~~~v~~~v~~~~~~gvp~~Klvl 258 (570)
+..+ ....|+++++.++|||||||+||++|+|....++|+|||+.... ..+++.+|++|++.|+|++||+|
T Consensus 158 ~~~~~~~~~~~~~~yd~~~l~~~vD~i~vMtYD~~g~~~~~~~~~~a~l~~~~~---~~~~~~~v~~~~~~g~p~~Klvl 234 (299)
T cd02879 158 YFSPILFLSDDSVSYPIEAINKNLDWVNVMAYDYYGSWESNTTGPAAALYDPNS---NVSTDYGIKSWIKAGVPAKKLVL 234 (299)
T ss_pred ccchhhccccccccCCHHHHHhhCCEEEEEeecccCCCCCCCCCCCCcCCCCCC---CCCHHHHHHHHHHcCCCHHHEEE
Confidence 5443 23578999999999999999999999998777899999997543 35899999999999999999999
Q ss_pred eccccccceeccCCCCCCCCCCCCCCCCCCCCcccHHHHHHHHhhCCCCeEEeecCceEEEEeecCCEEEeccCHHHHHH
Q 008332 259 CLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRA 338 (570)
Q Consensus 259 Gip~yG~~~~~~~~~~~~~g~~~~g~~~~~~g~~~y~~i~~~~~~~~~~~~~~~d~~~~~~y~~~~~~~i~ydd~~Si~~ 338 (570)
|||||||.|++ ||+.+..+|...+++||+|||++|++.
T Consensus 235 Gvp~YGr~~~~------------------------------------------~D~~~~~~y~~~~~~wi~ydd~~Si~~ 272 (299)
T cd02879 235 GLPLYGRAWTL------------------------------------------YDTTTVSSYVYAGTTWIGYDDVQSIAV 272 (299)
T ss_pred Eeccccccccc------------------------------------------cCCCcceEEEEECCEEEEeCCHHHHHH
Confidence 99999999953 566777788888899999999999999
Q ss_pred HHHhhhccCCceEEEEEccccChhh
Q 008332 339 KIAYAKEKRLLGYYAWQVSFDDHDW 363 (570)
Q Consensus 339 K~~~~~~~gLgGv~~W~l~~Dd~~~ 363 (570)
|++||+++||||+|+|++++||+++
T Consensus 273 K~~~a~~~~lgGv~~W~l~~Dd~~~ 297 (299)
T cd02879 273 KVKYAKQKGLLGYFAWAVGYDDNNW 297 (299)
T ss_pred HHHHHHhCCCCeEEEEEeecCCccc
Confidence 9999999999999999999999885
|
The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity. |
| >cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >KOG2806 consensus Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02878 GH18_zymocin_alpha Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >smart00636 Glyco_18 Glycosyl hydrolase family 18 | Back alignment and domain information |
|---|
| >cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
| >cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >COG3858 Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >KOG2091 consensus Predicted member of glycosyl hydrolase family 18 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain | Back alignment and domain information |
|---|
| >cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain | Back alignment and domain information |
|---|
| >COG3469 Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4701 consensus Chitinase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >KOG0586 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0589 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PRK10345 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0584 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >PRK14879 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03724 arch_bud32 Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain | Back alignment and domain information |
|---|
| >KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family | Back alignment and domain information |
|---|
| >KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12274 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05119 RIO RIO kinase family, catalytic domain | Back alignment and domain information |
|---|
| >KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins | Back alignment and domain information |
|---|
| >PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] | Back alignment and domain information |
|---|
| >KOG2331 consensus Predicted glycosylhydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05151 ChoK Choline Kinase (ChoK) | Back alignment and domain information |
|---|
| >COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15102 TMEM154: TMEM154 protein family | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region | Back alignment and domain information |
|---|
| >COG0661 AarF Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 | Back alignment and domain information |
|---|
| >KOG1243 consensus Protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane | Back alignment and domain information |
|---|
| >KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10593 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] | Back alignment and domain information |
|---|
| >PRK09550 mtnK methylthioribose kinase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 570 | ||||
| 3alg_A | 353 | Crystal Structure Of Class V Chitinase (E115q Mutan | 4e-60 | ||
| 3alf_A | 353 | Crystal Structure Of Class V Chitinase From Nicotia | 4e-60 | ||
| 3aqu_A | 356 | Crystal Structure Of A Class V Chitinase From Arabi | 5e-60 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 6e-28 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 1e-27 | ||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 1e-27 | ||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 1e-27 | ||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 2e-27 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 8e-25 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 1e-23 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 1e-23 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 1e-22 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 3e-22 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 7e-20 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 2e-19 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 2e-19 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 3e-19 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 4e-19 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 5e-19 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 6e-19 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 7e-19 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 1e-18 | ||
| 3uim_A | 326 | Structural Basis For The Impact Of Phosphorylation | 6e-18 | ||
| 3tl8_A | 349 | The Avrptob-Bak1 Complex Reveals Two Structurally S | 7e-18 | ||
| 1itx_A | 419 | Catalytic Domain Of Chitinase A1 From Bacillus Circ | 8e-14 | ||
| 2nru_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 7e-13 | ||
| 2nry_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 7e-13 | ||
| 2oib_A | 301 | Crystal Structure Of Irak4 Kinase Domain Apo Form L | 7e-13 | ||
| 2qkw_B | 321 | Structural Basis For Activation Of Plant Immunity B | 2e-12 | ||
| 3hgk_A | 327 | Crystal Structure Of Effect Protein Avrptob Complex | 2e-12 | ||
| 3g6l_A | 406 | The Crystal Structure Of A Chitinase Crchi1 From Th | 3e-12 | ||
| 2o8y_A | 298 | Apo Irak4 Kinase Domain Length = 298 | 1e-11 | ||
| 1jnd_A | 420 | Crystal Structure Of Imaginal Disc Growth Factor-2 | 1e-10 | ||
| 1eib_A | 540 | Crystal Structure Of Chitinase A Mutant D313a Compl | 3e-10 | ||
| 1rd6_A | 563 | Crystal Structure Of S. Marcescens Chitinase A Muta | 3e-10 | ||
| 1ll7_A | 392 | Structure Of The E171q Mutant Of C. Immitis Chitina | 4e-10 | ||
| 1d2k_A | 392 | C. Immitis Chitinase 1 At 2.2 Angstroms Resolution | 4e-10 | ||
| 2wly_A | 548 | Chitinase A From Serratia Marcescens Atcc990 In Com | 4e-10 | ||
| 1ll6_A | 392 | Structure Of The D169n Mutant Of C. Immitis Chitina | 4e-10 | ||
| 2wk2_A | 540 | Chitinase A From Serratia Marcescens Atcc990 In Com | 4e-10 | ||
| 1k9t_A | 540 | Chitinase A Complexed With Tetra-N-Acetylchitotrios | 1e-09 | ||
| 1ctn_A | 540 | Crystal Structure Of A Bacterial Chitinase At 2.3 A | 1e-09 | ||
| 1ffr_A | 540 | Crystal Structure Of Chitinase A Mutant Y390f Compl | 1e-09 | ||
| 1ehn_A | 540 | Crystal Structure Of Chitinase A Mutant E315q Compl | 1e-09 | ||
| 1edq_A | 540 | Crystal Structure Of Chitinase A From S. Marcescens | 1e-09 | ||
| 1nh6_A | 540 | Structure Of S. Marcescens Chitinase A, E315l, Comp | 1e-09 | ||
| 1w9p_A | 433 | Specificity And Affinity Of Natural Product Cyclope | 3e-09 | ||
| 1wno_A | 395 | Crystal Structure Of A Native Chitinase From Asperg | 4e-09 | ||
| 3ars_A | 584 | Crystal Structure Analysis Of Chitinase A From Vibr | 1e-08 | ||
| 3gvu_A | 292 | The Crystal Structure Of Human Abl2 In Complex With | 2e-08 | ||
| 1ur9_A | 499 | Interactions Of A Family 18 Chitinase With The Desi | 4e-08 | ||
| 1h0g_A | 499 | Complex Of A Chitinase With The Natural Product Cyc | 4e-08 | ||
| 1e6n_B | 499 | Chitinase B From Serratia Marcescens Inactive Mutan | 5e-08 | ||
| 1e15_A | 499 | Chitinase B From Serratia Marcescens Length = 499 | 5e-08 | ||
| 1ogb_A | 499 | Chitinase B From Serratia Marcescens Mutant D142n L | 5e-08 | ||
| 1e6z_A | 498 | Chitinase B From Serratia Marcescens Wildtype In Co | 5e-08 | ||
| 3b9a_A | 584 | Crystal Structure Of Vibrio Harveyi Chitinase A Com | 8e-08 | ||
| 3b8s_A | 584 | Crystal Structure Of Wild-Type Chitinase A From Vib | 8e-08 | ||
| 1goi_A | 499 | Crystal Structure Of The D140n Mutant Of Chitinase | 2e-07 | ||
| 3dk7_A | 277 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 2e-07 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 3e-07 | ||
| 4f0i_A | 300 | Crystal Structure Of Apo Trka Length = 300 | 3e-07 | ||
| 4gt5_A | 306 | Crystal Structure Of The Inactive Trka Kinase Domai | 3e-07 | ||
| 3dk3_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 3e-07 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 4e-07 | ||
| 3qrj_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain T | 4e-07 | ||
| 4aoj_A | 329 | Human Trka In Complex With The Inhibitor Az-23 Leng | 4e-07 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 4e-07 | ||
| 2z60_A | 288 | Crystal Structure Of The T315i Mutant Of Abl Kinase | 4e-07 | ||
| 3qri_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain I | 4e-07 | ||
| 2gqg_A | 278 | X-Ray Crystal Structure Of Dasatinib (Bms-354825) B | 4e-07 | ||
| 2hyy_A | 273 | Human Abl Kinase Domain In Complex With Imatinib (S | 4e-07 | ||
| 2v7a_A | 286 | Crystal Structure Of The T315i Abl Mutant In Comple | 4e-07 | ||
| 3oy3_A | 284 | Crystal Structure Of Abl T315i Mutant Kinase Domain | 4e-07 | ||
| 2hzi_A | 277 | Abl Kinase Domain In Complex With Pd180970 Length = | 4e-07 | ||
| 2hz0_A | 270 | Abl Kinase Domain In Complex With Nvp-Aeg082 Length | 5e-07 | ||
| 1fpu_A | 293 | Crystal Structure Of Abl Kinase Domain In Complex W | 5e-07 | ||
| 2hiw_A | 287 | Crystal Structure Of Inactive Conformation Abl Kina | 5e-07 | ||
| 2qoh_A | 288 | Crystal Structure Of Abl Kinase Bound With Ppy-a Le | 5e-07 | ||
| 3pyy_A | 298 | Discovery And Characterization Of A Cell-Permeable, | 5e-07 | ||
| 2e2b_A | 293 | Crystal Structure Of The C-Abl Kinase Domain In Com | 5e-07 | ||
| 2f4j_A | 287 | Structure Of The Kinase Domain Of An Imatinib-Resis | 5e-07 | ||
| 2g2f_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 5e-07 | ||
| 2g1t_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 5e-07 | ||
| 3oxz_A | 284 | Crystal Structure Of Abl Kinase Domain Bound With A | 5e-07 | ||
| 2xa4_A | 298 | Inhibitors Of Jak2 Kinase Domain Length = 298 | 8e-07 | ||
| 2w1i_A | 326 | Structure Determination Of Aurora Kinase In Complex | 8e-07 | ||
| 4hge_A | 300 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 | 8e-07 | ||
| 4aqc_A | 301 | Triazolopyridine-Based Inhibitor Of Janus Kinase 2 | 8e-07 | ||
| 4bbe_A | 298 | Aminoalkylpyrimidine Inhibitor Complexes With Jak2 | 8e-07 | ||
| 3tjc_A | 298 | Co-Crystal Structure Of Jak2 With Thienopyridine 8 | 8e-07 | ||
| 3e62_A | 293 | Fragment Based Discovery Of Jak-2 Inhibitors Length | 8e-07 | ||
| 4e4m_A | 302 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 | 9e-07 | ||
| 3rvg_A | 303 | Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido | 9e-07 | ||
| 3lpb_A | 295 | Crystal Structure Of Jak2 Complexed With A Potent 2 | 9e-07 | ||
| 3dk6_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 9e-07 | ||
| 3q32_A | 301 | Structure Of Janus Kinase 2 With A Pyrrolotriazine | 9e-07 | ||
| 2b7a_A | 293 | The Structural Basis Of Janus Kinase 2 Inhibition B | 9e-07 | ||
| 3ugc_A | 295 | Structural Basis Of Jak2 Inhibition By The Type Ii | 1e-06 | ||
| 3jy9_A | 311 | Janus Kinase 2 Inhibitors Length = 311 | 1e-06 | ||
| 3io7_A | 313 | 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel | 1e-06 | ||
| 4asz_A | 299 | Crystal Structure Of Apo Trkb Kinase Domain Length | 1e-06 | ||
| 3bbt_B | 328 | Crystal Structure Of The Erbb4 Kinase In Complex Wi | 2e-06 | ||
| 2r4b_A | 321 | Erbb4 Kinase Domain Complexed With A Thienopyrimidi | 2e-06 | ||
| 4e6d_A | 298 | Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W | 2e-06 | ||
| 1kfw_A | 435 | Structure Of Catalytic Domain Of Psychrophilic Chit | 4e-06 | ||
| 4gt4_A | 308 | Structure Of Unliganded, Inactive Ror2 Kinase Domai | 4e-06 | ||
| 3zzw_A | 289 | Crystal Structure Of The Kinase Domain Of Ror2 Leng | 4e-06 | ||
| 4f1o_A | 287 | Crystal Structure Of The L1180t Mutant Roco4 Kinase | 5e-06 | ||
| 4f1m_A | 287 | Crystal Structure Of The G1179s Roco4 Kinase Domain | 5e-06 | ||
| 4f0f_A | 287 | Crystal Structure Of The Roco4 Kinase Domain Bound | 5e-06 | ||
| 3v5q_A | 297 | Discovery Of A Selective Trk Inhibitor With Efficac | 6e-06 | ||
| 4fnw_A | 327 | Crystal Structure Of The Apo F1174l Anaplastic Lymp | 1e-05 | ||
| 2yjr_A | 342 | Structure Of F1174l Mutant Anaplastic Lymphoma Kina | 1e-05 | ||
| 4fob_A | 353 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 2e-05 | ||
| 4dce_A | 333 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 3e-05 | ||
| 4fnx_A | 327 | Crystal Structure Of The Apo R1275q Anaplastic Lymp | 3e-05 | ||
| 4fnz_A | 327 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 3e-05 | ||
| 2xb7_A | 315 | Structure Of Human Anaplastic Lymphoma Kinase In Co | 4e-05 | ||
| 3l9p_A | 367 | Crystal Structure Of The Anaplastic Lymphoma Kinase | 4e-05 | ||
| 3lct_A | 344 | Crystal Structure Of The Anaplastic Lymphoma Kinase | 4e-05 | ||
| 3aox_A | 344 | X-Ray Crystal Structure Of Human Anaplastic Lymphom | 4e-05 | ||
| 2yhv_A | 342 | Structure Of L1196m Mutant Anaplastic Lymphoma Kina | 4e-05 | ||
| 2yfx_A | 327 | Structure Of L1196m Mutant Anaplastic Lymphoma Kina | 4e-05 | ||
| 1luf_A | 343 | Crystal Structure Of The Musk Tyrosine Kinase: Insi | 4e-05 | ||
| 2xp2_A | 327 | Structure Of The Human Anaplastic Lymphoma Kinase I | 4e-05 | ||
| 2gsf_A | 373 | The Human Epha3 Receptor Tyrosine Kinase And Juxtam | 4e-05 | ||
| 2qof_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f | 5e-05 | ||
| 2qod_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y602f | 5e-05 | ||
| 2qoo_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 5e-05 | ||
| 2qoi_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 5e-05 | ||
| 3fxx_A | 371 | Human Epha3 Kinase And Juxtamembrane Region Bound T | 5e-05 | ||
| 2qok_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 5e-05 | ||
| 2qol_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596:y | 5e-05 | ||
| 2yjs_A | 342 | Structure Of C1156y Mutant Anaplastic Lymphoma Kina | 6e-05 | ||
| 3omv_A | 307 | Crystal Structure Of C-Raf (Raf-1) Length = 307 | 6e-05 | ||
| 2qoc_A | 344 | Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp | 7e-05 | ||
| 3kex_A | 325 | Crystal Structure Of The Catalytically Inactive Kin | 7e-05 | ||
| 3dzq_A | 361 | Human Epha3 Kinase Domain In Complex With Inhibitor | 7e-05 | ||
| 3lmg_A | 344 | Crystal Structure Of The Erbb3 Kinase Domain In Com | 7e-05 | ||
| 2r2p_A | 295 | Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep | 1e-04 | ||
| 1mqb_A | 333 | Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro | 1e-04 | ||
| 2vwu_A | 302 | Ephb4 Kinase Domain Inhibitor Complex Length = 302 | 1e-04 | ||
| 3ii5_A | 306 | The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi | 1e-04 | ||
| 4g9r_A | 307 | B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr | 1e-04 | ||
| 3idp_A | 300 | B-Raf V600e Kinase Domain In Complex With An Aminoi | 1e-04 | ||
| 3d4q_A | 307 | Pyrazole-Based Inhibitors Of B-Raf Kinase Length = | 2e-04 | ||
| 3qok_A | 420 | Crystal Structure Of Putative Chitinase Ii From Kle | 2e-04 | ||
| 4aw5_A | 291 | Complex Of The Ephb4 Kinase Domain With An Oxindole | 2e-04 | ||
| 2p0c_A | 313 | Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro | 2e-04 | ||
| 3coh_A | 268 | Crystal Structure Of Aurora-A In Complex With A Pen | 2e-04 | ||
| 4dbn_A | 284 | Crystal Structure Of The Kinase Domain Of Human B-R | 2e-04 | ||
| 3q96_A | 282 | B-Raf Kinase Domain In Complex With A Tetrahydronap | 2e-04 | ||
| 2fb8_A | 281 | Structure Of The B-Raf Kinase Domain Bound To Sb-59 | 2e-04 | ||
| 4h58_A | 275 | Braf In Complex With Compound 3 Length = 275 | 2e-04 | ||
| 1uwh_A | 276 | The Complex Of Wild Type B-Raf And Bay439006 Length | 2e-04 | ||
| 3c4c_A | 280 | B-Raf Kinase In Complex With Plx4720 Length = 280 | 2e-04 | ||
| 1uwj_A | 276 | The Complex Of Mutant V599e B-raf And Bay439006 Len | 2e-04 | ||
| 4eoj_A | 302 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 2e-04 | ||
| 2iw6_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com | 3e-04 | ||
| 3ezr_A | 300 | Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ | 3e-04 | ||
| 1e9h_A | 297 | Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex | 3e-04 | ||
| 4eos_A | 300 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 3e-04 | ||
| 4eoo_A | 299 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 3e-04 | ||
| 4eoi_A | 299 | Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc | 3e-04 | ||
| 3og7_A | 289 | B-Raf Kinase V600e Oncogenic Mutant In Complex With | 3e-04 | ||
| 4eok_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 3e-04 | ||
| 4eop_A | 300 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 3e-04 | ||
| 2jgz_A | 289 | Crystal Structure Of Phospho-Cdk2 In Complex With C | 3e-04 | ||
| 4eoq_A | 301 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 3e-04 | ||
| 4bcq_A | 301 | Structure Of Cdk2 In Complex With Cyclin A And A 2- | 3e-04 | ||
| 3bht_A | 300 | Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN | 3e-04 | ||
| 1ogu_A | 302 | Structure Of Human Thr160-phospho Cdk2/cyclin A Com | 3e-04 | ||
| 4fk3_A | 292 | B-Raf Kinase V600e Oncogenic Mutant In Complex With | 3e-04 | ||
| 1qmz_A | 299 | Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com | 3e-04 | ||
| 1w98_A | 298 | The Structural Basis Of Cdk2 Activation By Cyclin E | 3e-04 | ||
| 1h1p_A | 303 | Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP | 3e-04 | ||
| 4eom_A | 301 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 3e-04 | ||
| 4eon_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 3e-04 | ||
| 1gz8_A | 299 | Human Cyclin Dependent Kinase 2 Complexed With The | 3e-04 | ||
| 1vyw_A | 309 | Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = | 3e-04 | ||
| 1pf8_A | 298 | Crystal Structure Of Human Cyclin-dependent Kinase | 3e-04 | ||
| 4i3z_A | 296 | Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES | 3e-04 | ||
| 2wtv_A | 285 | Aurora-A Inhibitor Structure Length = 285 | 3e-04 | ||
| 2qon_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 3e-04 | ||
| 1oit_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 3e-04 | ||
| 2w17_A | 299 | Cdk2 In Complex With The Imidazole Pyrimidine Amide | 3e-04 | ||
| 1fin_A | 298 | Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = | 3e-04 | ||
| 4erw_A | 306 | Cdk2 In Complex With Staurosporine Length = 306 | 3e-04 | ||
| 1jst_A | 298 | Phosphorylated Cyclin-Dependent Kinase-2 Bound To C | 3e-04 | ||
| 3qhr_A | 298 | Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic | 3e-04 | ||
| 2wtw_A | 285 | Aurora-A Inhibitor Structure (2nd Crystal Form) Len | 3e-04 | ||
| 2qo7_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Dephos | 3e-04 | ||
| 3pj8_A | 299 | Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] | 4e-04 | ||
| 3a4o_X | 286 | Lyn Kinase Domain Length = 286 | 4e-04 | ||
| 3pxf_A | 306 | Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N | 4e-04 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 4e-04 | ||
| 3qbn_A | 281 | Structure Of Human Aurora A In Complex With A Diami | 4e-04 | ||
| 4hct_A | 269 | Crystal Structure Of Itk In Complex With Compound 5 | 4e-04 | ||
| 3d14_A | 272 | Crystal Structure Of Mouse Aurora A (Asn186->gly, L | 4e-04 | ||
| 3daj_A | 272 | Crystal Structure Of Aurora A Complexed With An Inh | 4e-04 | ||
| 3miy_A | 266 | X-Ray Crystal Structure Of Itk Complexed With Sunit | 4e-04 | ||
| 2zv7_A | 279 | Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | 4e-04 | ||
| 3h0y_A | 268 | Aurora A In Complex With A Bisanilinopyrimidine Len | 5e-04 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 5e-04 | ||
| 3v5j_A | 266 | Crystal Structure Of Interleukin-2 Inducible T-Cell | 5e-04 | ||
| 2c6e_A | 283 | Aurora A Kinase Activated Mutant (T287d) In Complex | 5e-04 | ||
| 1ol6_A | 282 | Structure Of Unphosphorylated D274n Mutant Of Auror | 5e-04 | ||
| 3lau_A | 287 | Crystal Structure Of Aurora2 Kinase In Complex With | 5e-04 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 5e-04 | ||
| 3r21_A | 271 | Design, Synthesis, And Biological Evaluation Of Pyr | 5e-04 | ||
| 2qob_A | 344 | Human Epha3 Kinase Domain, Base Structure Length = | 5e-04 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 5e-04 | ||
| 1sm2_A | 264 | Crystal Structure Of The Phosphorylated Interleukin | 5e-04 | ||
| 3unz_A | 279 | Aurora A In Complex With Rpm1679 Length = 279 | 5e-04 | ||
| 2xng_A | 283 | Structure Of Aurora-A Bound To A Selective Imidazop | 5e-04 | ||
| 3o50_A | 267 | Crystal Structure Of Benzamide 9 Bound To Auroraa L | 5e-04 | ||
| 3fdn_A | 279 | Structure-Based Drug Design Of Novel Aurora Kinase | 5e-04 | ||
| 2xne_A | 272 | Structure Of Aurora-A Bound To An Imidazopyrazine I | 5e-04 | ||
| 2c6d_A | 275 | Aurora A Kinase Activated Mutant (T287d) In Complex | 5e-04 | ||
| 1ol5_A | 282 | Structure Of Aurora-A 122-403, Phosphorylated On Th | 5e-04 | ||
| 3nrm_A | 283 | Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito | 5e-04 | ||
| 2x6d_A | 285 | Aurora-A Bound To An Inhibitor Length = 285 | 5e-04 | ||
| 2w1d_A | 275 | Structure Determination Of Aurora Kinase In Complex | 5e-04 | ||
| 2jiv_A | 328 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 5e-04 | ||
| 2iw8_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 | 5e-04 | ||
| 3ika_A | 331 | Crystal Structure Of Egfr 696-1022 T790m Mutant Cov | 5e-04 | ||
| 2jiu_A | 328 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 5e-04 | ||
| 4i1z_A | 329 | Crystal Structure Of The Monomeric (v948r) Form Of | 5e-04 | ||
| 3e5a_A | 268 | Crystal Structure Of Aurora A In Complex With Vx-68 | 5e-04 | ||
| 1muo_A | 297 | Crystal Structure Of Aurora-2, An Oncogenic Serine- | 5e-04 | ||
| 3w2o_A | 331 | Egfr Kinase Domain T790m/l858r Mutant With Tak-285 | 5e-04 | ||
| 2w1c_A | 275 | Structure Determination Of Aurora Kinase In Complex | 5e-04 | ||
| 2j50_A | 280 | Structure Of Aurora-2 In Complex With Pha-739358 Le | 5e-04 | ||
| 3ha6_A | 268 | Crystal Structure Of Aurora A In Complex With Tpx2 | 5e-04 | ||
| 2jit_A | 327 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 5e-04 | ||
| 2xru_A | 280 | Aurora-A T288e Complexed With Pha-828300 Length = 2 | 6e-04 | ||
| 1mq4_A | 272 | Crystal Structure Of Aurora-A Protein Kinase Length | 6e-04 | ||
| 4i21_A | 329 | Crystal Structure Of L858r + T790m Egfr Kinase Doma | 6e-04 | ||
| 1gii_A | 298 | Human Cyclin Dependent Kinase 2 Complexed With The | 6e-04 | ||
| 4g5p_A | 330 | Crystal Structure Of Egfr Kinase T790m In Complex W | 6e-04 | ||
| 2bmc_A | 306 | Aurora-2 T287d T288d Complexed With Pha-680632 Leng | 6e-04 | ||
| 4i24_A | 329 | Structure Of T790m Egfr Kinase Domain Co-crystalliz | 6e-04 | ||
| 3qgw_A | 286 | Crystal Structure Of Itk Kinase Bound To An Inhibit | 6e-04 | ||
| 4af3_A | 292 | Human Aurora B Kinase In Complex With Incenp And Vx | 6e-04 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 6e-04 | ||
| 2j4z_A | 306 | Structure Of Aurora-2 In Complex With Pha-680626 Le | 6e-04 | ||
| 4hjo_A | 337 | Crystal Structure Of The Inactive Egfr Tyrosine Kin | 7e-04 | ||
| 1m14_A | 333 | Tyrosine Kinase Domain From Epidermal Growth Factor | 7e-04 | ||
| 2itt_A | 327 | Crystal Structure Of Egfr Kinase Domain L858r Mutat | 7e-04 | ||
| 3oz6_A | 388 | Crystal Structure Of Mapk From Cryptosporidium Parv | 7e-04 | ||
| 2j5e_A | 327 | Crystal Structure Of Egfr Kinase Domain In Complex | 7e-04 | ||
| 4i20_A | 329 | Crystal Structure Of Monomeric (v948r) Primary Onco | 7e-04 | ||
| 2wqe_A | 262 | Structure Of S155r Aurora-A Somatic Mutant Length = | 7e-04 | ||
| 3dqw_A | 286 | C-Src Kinase Domain Thr338ile Mutant In Complex Wit | 7e-04 | ||
| 3bel_A | 315 | X-Ray Structure Of Egfr In Complex With Oxime Inhib | 7e-04 | ||
| 3lvp_A | 336 | Crystal Structure Of Bisphosphorylated Igf1-R Kinas | 7e-04 | ||
| 3g6h_A | 286 | Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma | 7e-04 | ||
| 2gs7_A | 330 | Crystal Structure Of The Inactive Egfr Kinase Domai | 7e-04 | ||
| 2eb3_A | 334 | Crystal Structure Of Mutated Egfr Kinase Domain (L8 | 7e-04 | ||
| 2j5f_A | 327 | Crystal Structure Of Egfr Kinase Domain In Complex | 7e-04 | ||
| 1xkk_A | 352 | Egfr Kinase Domain Complexed With A Quinazoline Inh | 8e-04 | ||
| 1jqh_A | 308 | Igf-1 Receptor Kinase Domain Length = 308 | 8e-04 | ||
| 3lw0_A | 304 | Igf-1rk In Complex With Ligand Msc1609119a-1 Length | 8e-04 | ||
| 2oj9_A | 307 | Structure Of Igf-1r Kinase Domain Complexed With A | 8e-04 | ||
| 2gs2_A | 330 | Crystal Structure Of The Active Egfr Kinase Domain | 8e-04 | ||
| 4g5j_A | 330 | Crystal Structure Of Egfr Kinase In Complex With Bi | 8e-04 | ||
| 3vjo_A | 334 | Crystal Structure Of The Wild-Type Egfr Kinase Doma | 8e-04 | ||
| 4i23_A | 329 | Crystal Structure Of The Wild-type Egfr Kinase Doma | 8e-04 | ||
| 2rfd_A | 324 | Crystal Structure Of The Complex Between The Egfr K | 8e-04 | ||
| 3i81_A | 315 | Crystal Structure Of Insulin-Like Growth Factor 1 R | 8e-04 | ||
| 3geq_A | 286 | Structural Basis For The Chemical Rescue Of Src Kin | 8e-04 | ||
| 2zm3_A | 308 | Complex Structure Of Insulin-Like Growth Factor Rec | 8e-04 | ||
| 1p4o_A | 322 | Structure Of Apo Unactivated Igf-1r Kinase Domain A | 8e-04 | ||
| 2oiq_A | 286 | Crystal Structure Of Chicken C-Src Kinase Domain In | 9e-04 | ||
| 2bdf_A | 279 | Src Kinase In Complex With Inhibitor Ap23451 Length | 9e-04 | ||
| 1m7n_A | 322 | Crystal Structure Of Unactivated Apo Insulin-Like G | 9e-04 |
| >pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 | Back alignment and structure |
|
| >pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 | Back alignment and structure |
| >pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 | Back alignment and structure |
| >pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 | Back alignment and structure |
| >pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 | Back alignment and structure |
| >pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 | Back alignment and structure |
| >pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 | Back alignment and structure |
| >pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 | Back alignment and structure |
| >pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 | Back alignment and structure |
| >pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 | Back alignment and structure |
| >pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 | Back alignment and structure |
| >pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 | Back alignment and structure |
| >pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 | Back alignment and structure |
| >pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 | Back alignment and structure |
| >pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 | Back alignment and structure |
| >pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 | Back alignment and structure |
| >pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 | Back alignment and structure |
| >pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 | Back alignment and structure |
| >pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 | Back alignment and structure |
| >pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 | Back alignment and structure |
| >pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 | Back alignment and structure |
| >pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 | Back alignment and structure |
| >pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 | Back alignment and structure |
| >pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 | Back alignment and structure |
| >pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 | Back alignment and structure |
| >pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 | Back alignment and structure |
| >pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 | Back alignment and structure |
| >pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 | Back alignment and structure |
| >pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 | Back alignment and structure |
| >pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 | Back alignment and structure |
| >pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 | Back alignment and structure |
| >pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 | Back alignment and structure |
| >pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 | Back alignment and structure |
| >pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 | Back alignment and structure |
| >pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 | Back alignment and structure |
| >pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 | Back alignment and structure |
| >pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 | Back alignment and structure |
| >pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 | Back alignment and structure |
| >pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 | Back alignment and structure |
| >pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 | Back alignment and structure |
| >pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 | Back alignment and structure |
| >pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 | Back alignment and structure |
| >pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 | Back alignment and structure |
| >pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 | Back alignment and structure |
| >pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 | Back alignment and structure |
| >pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 | Back alignment and structure |
| >pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 | Back alignment and structure |
| >pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 | Back alignment and structure |
| >pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 | Back alignment and structure |
| >pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 | Back alignment and structure |
| >pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 | Back alignment and structure |
| >pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 | Back alignment and structure |
| >pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 | Back alignment and structure |
| >pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 | Back alignment and structure |
| >pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 | Back alignment and structure |
| >pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 | Back alignment and structure |
| >pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 | Back alignment and structure |
| >pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 | Back alignment and structure |
| >pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 | Back alignment and structure |
| >pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 | Back alignment and structure |
| >pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 | Back alignment and structure |
| >pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 | Back alignment and structure |
| >pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 | Back alignment and structure |
| >pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 | Back alignment and structure |
| >pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 | Back alignment and structure |
| >pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 | Back alignment and structure |
| >pdb|1KFW|A Chain A, Structure Of Catalytic Domain Of Psychrophilic Chitinase B From Arthrobacter Tad20 Length = 435 | Back alignment and structure |
| >pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 | Back alignment and structure |
| >pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 | Back alignment and structure |
| >pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 | Back alignment and structure |
| >pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 | Back alignment and structure |
| >pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 | Back alignment and structure |
| >pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 | Back alignment and structure |
| >pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 | Back alignment and structure |
| >pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 | Back alignment and structure |
| >pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 | Back alignment and structure |
| >pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 | Back alignment and structure |
| >pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 | Back alignment and structure |
| >pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 | Back alignment and structure |
| >pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 | Back alignment and structure |
| >pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 | Back alignment and structure |
| >pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 | Back alignment and structure |
| >pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 | Back alignment and structure |
| >pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 | Back alignment and structure |
| >pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 | Back alignment and structure |
| >pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 | Back alignment and structure |
| >pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 | Back alignment and structure |
| >pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 | Back alignment and structure |
| >pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 | Back alignment and structure |
| >pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 | Back alignment and structure |
| >pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 | Back alignment and structure |
| >pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 | Back alignment and structure |
| >pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 | Back alignment and structure |
| >pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 | Back alignment and structure |
| >pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 | Back alignment and structure |
| >pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 | Back alignment and structure |
| >pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 | Back alignment and structure |
| >pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 | Back alignment and structure |
| >pdb|3QOK|A Chain A, Crystal Structure Of Putative Chitinase Ii From Klebsiella Pneumoniae Length = 420 | Back alignment and structure |
| >pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 | Back alignment and structure |
| >pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 | Back alignment and structure |
| >pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 | Back alignment and structure |
| >pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 | Back alignment and structure |
| >pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 | Back alignment and structure |
| >pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 | Back alignment and structure |
| >pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 | Back alignment and structure |
| >pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 | Back alignment and structure |
| >pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 | Back alignment and structure |
| >pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 | Back alignment and structure |
| >pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 | Back alignment and structure |
| >pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 | Back alignment and structure |
| >pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 | Back alignment and structure |
| >pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 | Back alignment and structure |
| >pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 | Back alignment and structure |
| >pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 | Back alignment and structure |
| >pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 | Back alignment and structure |
| >pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 | Back alignment and structure |
| >pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 | Back alignment and structure |
| >pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 | Back alignment and structure |
| >pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 | Back alignment and structure |
| >pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 | Back alignment and structure |
| >pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 | Back alignment and structure |
| >pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 | Back alignment and structure |
| >pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 | Back alignment and structure |
| >pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 | Back alignment and structure |
| >pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 | Back alignment and structure |
| >pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 | Back alignment and structure |
| >pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 | Back alignment and structure |
| >pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 | Back alignment and structure |
| >pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 | Back alignment and structure |
| >pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 | Back alignment and structure |
| >pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 | Back alignment and structure |
| >pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 | Back alignment and structure |
| >pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 | Back alignment and structure |
| >pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 | Back alignment and structure |
| >pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 | Back alignment and structure |
| >pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 | Back alignment and structure |
| >pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 | Back alignment and structure |
| >pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 | Back alignment and structure |
| >pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 | Back alignment and structure |
| >pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 | Back alignment and structure |
| >pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | Back alignment and structure |
| >pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 | Back alignment and structure |
| >pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 | Back alignment and structure |
| >pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 | Back alignment and structure |
| >pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 | Back alignment and structure |
| >pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
| >pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 | Back alignment and structure |
| >pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 | Back alignment and structure |
| >pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 | Back alignment and structure |
| >pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 | Back alignment and structure |
| >pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 | Back alignment and structure |
| >pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 | Back alignment and structure |
| >pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 | Back alignment and structure |
| >pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 | Back alignment and structure |
| >pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 | Back alignment and structure |
| >pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 | Back alignment and structure |
| >pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 | Back alignment and structure |
| >pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 | Back alignment and structure |
| >pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 | Back alignment and structure |
| >pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 | Back alignment and structure |
| >pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 | Back alignment and structure |
| >pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 | Back alignment and structure |
| >pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 | Back alignment and structure |
| >pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 | Back alignment and structure |
| >pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 | Back alignment and structure |
| >pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 | Back alignment and structure |
| >pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 | Back alignment and structure |
| >pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 | Back alignment and structure |
| >pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 | Back alignment and structure |
| >pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 | Back alignment and structure |
| >pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 | Back alignment and structure |
| >pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 | Back alignment and structure |
| >pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 | Back alignment and structure |
| >pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 | Back alignment and structure |
| >pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 | Back alignment and structure |
| >pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 | Back alignment and structure |
| >pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 | Back alignment and structure |
| >pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 | Back alignment and structure |
| >pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 | Back alignment and structure |
| >pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 | Back alignment and structure |
| >pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 | Back alignment and structure |
| >pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 | Back alignment and structure |
| >pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 | Back alignment and structure |
| >pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 | Back alignment and structure |
| >pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 | Back alignment and structure |
| >pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 | Back alignment and structure |
| >pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 | Back alignment and structure |
| >pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 | Back alignment and structure |
| >pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 | Back alignment and structure |
| >pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 | Back alignment and structure |
| >pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 | Back alignment and structure |
| >pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 | Back alignment and structure |
| >pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 | Back alignment and structure |
| >pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 | Back alignment and structure |
| >pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 | Back alignment and structure |
| >pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 | Back alignment and structure |
| >pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 | Back alignment and structure |
| >pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 | Back alignment and structure |
| >pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 | Back alignment and structure |
| >pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 | Back alignment and structure |
| >pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 | Back alignment and structure |
| >pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 | Back alignment and structure |
| >pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 | Back alignment and structure |
| >pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 570 | |||
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 2e-84 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 1e-83 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 5e-68 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 5e-66 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 9e-66 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 6e-63 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 2e-60 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 4e-47 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 1e-45 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 5e-44 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 6e-44 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 7e-44 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 1e-42 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 2e-42 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 3e-42 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 4e-40 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 2e-39 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 3e-39 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 1e-38 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 1e-38 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 4e-37 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 1e-33 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 2e-31 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 4e-27 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 4e-27 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 4e-26 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 1e-23 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 5e-18 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 4e-17 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 7e-17 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 1e-16 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 1e-16 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 2e-16 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 2e-16 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 2e-16 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 3e-16 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 4e-16 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 5e-16 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 6e-16 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 9e-16 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 1e-15 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 1e-15 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 1e-15 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 2e-15 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 3e-15 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 3e-15 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 4e-15 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 4e-15 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 4e-15 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 5e-15 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 7e-15 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 1e-14 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 2e-14 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 2e-14 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 2e-14 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 3e-14 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 3e-14 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 3e-14 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 3e-14 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 3e-14 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 4e-14 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 5e-14 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 6e-14 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 6e-14 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 7e-14 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 8e-14 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 9e-14 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 1e-13 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 1e-13 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 1e-13 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 2e-13 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 2e-13 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 2e-13 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 2e-13 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 2e-13 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 3e-13 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 3e-13 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 5e-13 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 6e-13 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 6e-13 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 1e-12 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 2e-12 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 2e-12 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 2e-12 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 2e-12 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 3e-12 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 3e-12 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 3e-12 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 3e-12 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 3e-12 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 3e-12 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 4e-12 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 1e-11 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 5e-11 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 9e-11 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 3e-10 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 5e-10 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 9e-10 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 2e-09 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 3e-09 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 4e-09 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 4e-09 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 5e-09 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 1e-08 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 1e-08 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 1e-08 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 2e-08 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 2e-08 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 3e-08 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 3e-08 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 3e-08 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 4e-08 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 5e-08 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 5e-08 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 5e-08 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 6e-08 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 6e-08 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 6e-08 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 7e-08 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 9e-08 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 1e-07 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 1e-07 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 1e-07 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 1e-07 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 1e-07 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 1e-07 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 2e-07 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 2e-07 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 2e-07 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 2e-07 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 2e-07 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-07 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 3e-07 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 3e-07 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 4e-07 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 4e-07 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 4e-07 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 7e-07 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 8e-07 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 1e-06 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 2e-06 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 2e-06 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 2e-06 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 2e-06 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 3e-06 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 3e-06 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 3e-06 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 4e-06 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 4e-06 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 5e-06 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 6e-06 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 6e-06 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 6e-06 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 7e-06 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 7e-06 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 7e-06 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 8e-06 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 8e-06 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 8e-06 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 8e-06 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 8e-06 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 9e-06 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 1e-05 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 1e-05 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 1e-05 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 2e-05 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 2e-05 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 3e-05 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 4e-05 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 5e-05 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 5e-05 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 5e-05 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 5e-05 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 5e-05 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 7e-05 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 9e-05 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 1e-04 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 1e-04 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 1e-04 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 2e-04 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 2e-04 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 2e-04 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 2e-04 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 2e-04 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 3e-04 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 3e-04 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 3e-04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 4e-04 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 5e-04 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 7e-04 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 8e-04 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 9e-04 |
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
Score = 266 bits (681), Expect = 2e-84
Identities = 132/358 (36%), Positives = 208/358 (58%), Gaps = 12/358 (3%)
Query: 24 KPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTV 83
+ ++ Y + ++ I+ LFTHL C+ AD+NS T Q+++S +++ + + F TV
Sbjct: 2 QTVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVS-SANQPKFSTFTQTV 60
Query: 84 KKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAP 143
+++NPS+ T+LSIG G + + Y+SM N + RKSFIDSSIR+AR YGF GLD W P
Sbjct: 61 QRRNPSVKTLLSIG-GGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYP 119
Query: 144 NTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPP--ANSYLLNSIQRN 201
+++T+M N G L EWR A + A+ S+ + L+L A YS + Y ++++ +
Sbjct: 120 SSATEMTNFGTLLREWRSA---VVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASS 176
Query: 202 LNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLP 261
L+W++ + +Y P + T PPAAL+ + S D ++WI+ GL A K V+ P
Sbjct: 177 LDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAGP--SGDAGTRSWIQAGLPAKKAVLGFP 234
Query: 262 FYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYF 321
+YGYAW L + A G A+ G + Y +I+ I G +YNST +Y
Sbjct: 235 YYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNG--ATTVYNSTVVGDYC 292
Query: 322 STGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQKDSITSAS 379
GT W G+DD +++ K+ YAK++ LLGY++W V DD + LS+AA+Q T+A+
Sbjct: 293 YAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADD-NSGLSRAASQAWDATTAT 349
|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 570 | |||
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 100.0 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 100.0 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 100.0 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 100.0 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 100.0 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 100.0 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 100.0 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 100.0 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 100.0 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 100.0 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 100.0 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 100.0 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 100.0 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 100.0 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 100.0 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 100.0 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 100.0 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 100.0 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 100.0 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 100.0 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 100.0 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 100.0 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 100.0 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 100.0 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 100.0 | |
| 4axn_A | 328 | Chitinase C1; hydrolase; 1.68A {Serratia marcescen | 100.0 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 100.0 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 100.0 | |
| 4ac1_X | 283 | Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g | 100.0 | |
| 2hvm_A | 273 | Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He | 99.97 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 99.97 | |
| 2uy2_A | 294 | Endochitinase; carbohydrate metabolism, polysaccha | 99.97 | |
| 2gsj_A | 271 | Protein PPL-2; mimosoideae, chimerolectin, endochi | 99.96 | |
| 1eok_A | 290 | Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b | 99.95 | |
| 1cnv_A | 299 | Concanavalin B; plant chitinase, chitin binding pr | 99.94 | |
| 2xtk_A | 310 | CHIA1, class III chitinase CHIA1; hydrolase, GH18; | 99.94 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 99.94 | |
| 1ta3_A | 274 | XIP-1, xylanase inhibitor protein I; beta alpha ba | 99.9 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 99.83 | |
| 3mu7_A | 273 | XAIP-II, xylanase and alpha-amylase inhibitor prot | 99.83 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 99.82 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 99.69 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.68 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.66 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.58 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.57 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.54 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.54 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.52 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.5 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.5 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.49 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 99.45 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 99.44 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.44 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.4 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.36 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 99.33 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.32 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.3 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.27 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.24 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.23 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.2 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.19 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.19 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.19 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.18 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.18 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.18 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.18 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.18 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 99.18 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.18 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.17 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.17 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.17 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.17 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.17 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.17 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.17 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.17 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.16 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.16 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.16 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.16 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 99.15 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.15 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.15 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.15 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.15 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.14 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 99.14 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 99.14 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.14 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.14 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.14 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.13 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.13 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.13 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.13 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.13 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 99.13 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.13 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.12 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 99.12 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.11 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 99.11 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.11 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.11 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.11 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.11 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.1 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.1 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.1 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.1 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.1 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.09 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.09 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.09 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.09 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 99.08 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 99.08 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 99.08 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.08 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.08 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.08 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.08 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.08 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 99.07 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.07 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 99.07 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 99.07 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 99.07 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 99.07 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 99.07 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.07 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 99.06 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.06 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 99.06 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.05 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.05 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.05 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.05 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.05 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 99.05 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 99.04 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 99.04 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.04 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 99.04 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 99.04 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.04 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.04 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.04 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.04 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.04 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 99.03 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.03 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 99.03 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 99.03 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 99.02 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.02 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.02 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 99.02 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.02 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.02 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 99.02 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.01 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 99.01 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 99.01 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.01 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.01 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 99.01 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.01 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 99.01 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.01 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 99.0 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.0 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 99.0 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.0 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 99.0 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.0 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 99.0 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.0 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 98.99 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 98.99 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 98.99 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 98.99 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 98.99 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 98.99 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 98.99 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 98.98 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 98.97 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 98.97 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 98.97 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 98.97 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 98.97 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 98.97 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 98.97 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 98.97 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 98.97 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 98.96 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 98.96 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 98.96 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 98.96 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 98.96 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 98.96 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 98.95 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 98.95 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 98.94 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 98.94 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 98.94 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 98.94 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 98.94 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 98.94 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 98.93 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 98.92 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 98.92 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 98.92 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 98.92 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 98.92 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 98.92 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 98.92 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 98.92 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 98.9 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 98.9 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 98.9 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 98.9 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 98.89 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 98.89 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 98.89 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 98.89 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 98.88 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 98.88 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 98.88 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 98.87 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 98.87 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 98.87 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 98.86 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 98.86 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 98.86 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 98.85 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 98.85 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 98.84 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 98.83 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 98.83 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 98.82 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 98.82 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 98.81 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 98.81 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 98.81 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 98.8 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 98.79 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 98.79 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 98.78 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 98.78 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 98.78 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 98.78 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 98.77 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 98.77 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 98.77 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 98.77 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 98.77 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 98.76 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 98.76 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 98.76 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 98.76 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 98.76 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 98.75 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 98.75 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 98.75 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 98.74 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 98.74 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 98.73 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 98.72 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 98.71 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 98.69 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 98.69 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 98.66 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 98.66 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 98.62 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 98.61 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 98.61 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 98.6 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 98.56 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 98.56 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 98.56 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 98.54 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 98.53 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 98.53 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 98.53 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 98.45 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 98.23 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 97.82 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 97.62 | |
| 2vtf_A | 626 | Endo-beta-N-acetylglucosaminidase; hydrolase, fami | 97.55 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 97.45 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 97.45 | |
| 3tm0_A | 263 | Aminoglycoside 3'-phosphotransferase; protein kina | 96.77 | |
| 3d1u_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 96.62 | |
| 1nd4_A | 264 | Aminoglycoside 3'-phosphotransferase; protein kina | 95.46 | |
| 3f7w_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 92.79 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 91.02 | |
| 3dxp_A | 359 | Putative acyl-COA dehydrogenase; protein kinase-li | 90.16 | |
| 3jr1_A | 312 | Putative fructosamine-3-kinase; YP_719053.1, struc | 87.72 | |
| 4gkh_A | 272 | Aminoglycoside 3'-phosphotransferase APHA1-IAB; py | 85.75 | |
| 2olc_A | 397 | MTR kinase, methylthioribose kinase; kinase ADP-2H | 81.72 |
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-68 Score=542.50 Aligned_cols=327 Identities=27% Similarity=0.413 Sum_probs=273.7
Q ss_pred eEEEEEecCCC-------CCcCCCCCCCCcceEEEEeEEEeCCceEEeeCCCccHHHHHHHHHHHHhhCCCceEEEEEcC
Q 008332 26 WIRVGYLNLSE-------VSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQ 98 (570)
Q Consensus 26 ~~vvgY~~~~~-------~~~~~~i~~~~~Thii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lk~~~~~~kvllsigg 98 (570)
.++||||++|+ .+.+++||+++||||+|+|+.+++++. ...+..+...+..+ ..+|++||++|+++||||
T Consensus 2 ~rvV~Yy~~W~~~r~~~~~~~~~~i~~~~~THi~yaFa~i~~~~~--~~~~~~~~~~~~~~-~~lK~~~p~lKvllSiGG 78 (365)
T 4ay1_A 2 YKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKV--IIKDKSEVMLYQTI-NSLKTKNPKLKILLSIGG 78 (365)
T ss_dssp CEEEEEEESGGGGSCTTSCCCGGGCCTTTCSEEEEEEEEEETTEE--ECCCTTHHHHHHHH-HHHHHHCTTCEEEEEEEE
T ss_pred eEEEEEECCccccCCCCCCCChhHCCcccCCEEEEEeEEecCCee--EECCccHHHHHHHH-HHHHHHCCCCEEEEEEeC
Confidence 58999999995 478999999999999999999998852 23334444445555 569999999999999999
Q ss_pred CCCCCcccccccccChHHHHHHHHHHHHHHHHcCCCceeeeccCCCCCCCccchhhhHHHHHHHHhhhhhcccccccceE
Q 008332 99 GKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLL 178 (570)
Q Consensus 99 ~~~~~~~~f~~~~~~~~~r~~fi~siv~~~~~~~~DGidiDwE~p~~~~~~~~~~~l~~~lr~~l~~~~~~~~~~~~~~~ 178 (570)
|+. ++..|+.+++++++|++||+|+++||++|+||||||||||| ...++.+|+.|+++||+++++...+.. +..+
T Consensus 79 w~~-~s~~Fs~~~~~~~~R~~Fi~siv~~~~~~~fDGiDiDWEyP-~~~d~~~~~~ll~elr~~~~~~~~~~~---~~~~ 153 (365)
T 4ay1_A 79 YLF-GSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYP-DQKENTHFTVLIHELAEAFQKDFTKST---KERL 153 (365)
T ss_dssp TTT-TTGGGTTGGGSHHHHHHHHHHHHHHHHHTTCCEEEEEESCC-HHHHHHHHHHHHHHHHHHHHHHHHTCS---SCCC
T ss_pred CCC-CCchHHHHHcCHHHHHHHHHHHHHHHHhcCCceEEEeeecC-CcccccccHHHHHHHHHHHHHHHhhhc---cCce
Confidence 875 56779999999999999999999999999999999999999 457889999999999999875432221 3345
Q ss_pred EEEeecccCCC--CCccChHHHhhhhceeeeecccCCCCCCCC-CCCCCCCCCCCCCCC---CccCHHHHHHHHHHcCCC
Q 008332 179 ILTARFRYSPP--ANSYLLNSIQRNLNWIHAVTASYYEPVSTN-FTAPPAALYGSISGR---FARSTDQVLKAWIERGLS 252 (570)
Q Consensus 179 ~~~~~~~~~~~--~~~~~~~~l~~~vD~i~vm~yd~~~~~~~~-~~~~~a~l~~~~~~~---~~~~v~~~v~~~~~~gvp 252 (570)
.++++++.... ...||++++.++|||||||+||+||+|+.. .+||+|||+...... ...+++.+|++|+++|+|
T Consensus 154 ~lt~a~~~~~~~~~~~~d~~~i~~~vD~inlMtYD~~g~w~~~~~tg~~apL~~~~~~~~~~~~~~v~~av~~~~~~gvp 233 (365)
T 4ay1_A 154 LLTAGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMP 233 (365)
T ss_dssp EEEEEEECCHHHHHHHCCHHHHHHHCSEEEEECCCSSCTTCSSCBCCCSSCSSCCTTCCGGGGGSSHHHHHHHHHHTTCC
T ss_pred EEEeecCCChhhhhhhcchhhhhhcccEEEEEcccccCcccCCCcCCCCCCCCCCccccCccccccHHHHHHHHHHcCCC
Confidence 55665554432 246999999999999999999999999865 689999999765432 345899999999999999
Q ss_pred CCceeeeccccccceeccCCCCCC----CCCCCCCCCCCCCCcccHHHHHHHHhhCCCCeEEeecCceEEEEeecCCEEE
Q 008332 253 ADKLVMCLPFYGYAWTLVKPEDNG----IGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWF 328 (570)
Q Consensus 253 ~~KlvlGip~yG~~~~~~~~~~~~----~g~~~~g~~~~~~g~~~y~~i~~~~~~~~~~~~~~~d~~~~~~y~~~~~~~i 328 (570)
++||+||||||||.|+++++.+.. .+....|+++.+.|.++|.|+|..++. ....|+..+..||...+++||
T Consensus 234 ~~KlvlGip~YGr~~~~~~~~~~~~~~~~~~~~~g~~t~~~g~~~y~e~~~~~~~----~~~~~~~~~~~~y~~~~~~~v 309 (365)
T 4ay1_A 234 SEKVVMGIPTYGHSFTLASAETTVGAPASGPGAAGPITESSGFLAYYEICQFLKG----AKITRLQDQQVPYAVKGNQWV 309 (365)
T ss_dssp GGGEEEEEESEEEEEEESSSCCSTTCBEEEECCCCTTTCCTTEEEHHHHHHHHTT----CEEEECTTTCCEEEEETTEEE
T ss_pred HHHeeeccCccceeeeecCCCCCCCCcccCCCCCccccccCCeeeHHHHHHHhcC----CceEEecCCeeEEEEECCEEE
Confidence 999999999999999998765432 122345677889999999999998754 456778888889999999999
Q ss_pred eccCHHHHHHHHHhhhccCCceEEEEEccccChhhH
Q 008332 329 GFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWL 364 (570)
Q Consensus 329 ~ydd~~Si~~K~~~~~~~gLgGv~~W~l~~Dd~~~~ 364 (570)
+|||++|+++|++||+++||||+|+|+|++||++..
T Consensus 310 sydd~~Si~~K~~y~~~~~LgGv~~W~l~~DD~~G~ 345 (365)
T 4ay1_A 310 GYDDVKSMETKVQFLKNLNLGGAMIWSIDMDDFTGK 345 (365)
T ss_dssp ECCCHHHHHHHHHHHHHTTCSEEEEECGGGSCTTST
T ss_pred EeCCHHHHHHHHHHHHhcCCCEEEEEeCCCcCCCCC
Confidence 999999999999999999999999999999998753
|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* | Back alignment and structure |
|---|
| >2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} | Back alignment and structure |
|---|
| >1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* | Back alignment and structure |
|---|
| >1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* | Back alignment and structure |
|---|
| >1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A | Back alignment and structure |
|---|
| >3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} | Back alignment and structure |
|---|
| >4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* | Back alignment and structure |
|---|
| >2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 570 | ||||
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 2e-33 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 4e-27 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 2e-04 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 9e-27 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 2e-26 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 8e-06 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 5e-26 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 6e-26 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 3e-05 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 2e-25 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 6e-24 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 9e-24 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 3e-23 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 3e-23 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 1e-22 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 2e-22 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 3e-22 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 7e-22 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 7e-22 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 7e-22 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 3e-21 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 4e-21 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 4e-21 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 7e-21 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 1e-20 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 1e-20 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 2e-20 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 4e-20 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 5e-20 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 5e-20 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 2e-19 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 3e-19 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 4e-19 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 6e-19 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 9e-19 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 1e-18 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 2e-18 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 2e-18 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 3e-18 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 4e-18 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 4e-18 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 5e-18 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 6e-18 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 8e-18 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 9e-18 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 2e-17 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 2e-07 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 2e-17 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 2e-17 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 2e-17 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 1e-16 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 1e-16 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 1e-16 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 6e-16 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 9e-16 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 1e-15 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 3e-15 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 6e-15 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 6e-15 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 1e-14 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 1e-14 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 2e-14 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 4e-14 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 5e-14 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 7e-14 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 7e-14 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 8e-14 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 2e-13 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 3e-13 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 4e-13 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 5e-13 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 7e-13 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 9e-13 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 1e-12 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 2e-12 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 2e-12 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 5e-12 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 7e-12 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 3e-10 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 9e-10 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 2e-08 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 1e-06 | |
| d1itxa2 | 72 | d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul | 3e-06 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 6e-06 | |
| d1edqa3 | 73 | d.26.3.1 (A:444-516) Chitinase A {Serratia marcesc | 1e-05 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 2e-05 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 4e-05 | |
| d1kfwa2 | 61 | d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar | 4e-05 | |
| d1ta3a_ | 274 | c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { | 3e-04 |
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Type II chitinase domain: Chitinase B, catalytic domain species: Serratia marcescens [TaxId: 615]
Score = 128 bits (323), Expect = 2e-33
Identities = 63/343 (18%), Positives = 117/343 (34%), Gaps = 55/343 (16%)
Query: 36 EVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFAD---TVKKKNPSITT 92
VS I+ TH+ S DINS + +++ + + +K NPS+
Sbjct: 30 PVSNITPAKAKQLTHINFSFLDINSNLE-CAWDPATNDAKARDVVNRLTALKAHNPSLRI 88
Query: 93 ILSIG-----QGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTST 147
+ SIG +++ Y + V+ + R F S +RI + YGF G++ W +
Sbjct: 89 MFSIGGWYYSNDLGVSHANYVNAVKTPASRAKFAQSCVRIMKDYGFDGVNIDWE-YPQAA 147
Query: 148 DMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPANSYL--LNSIQRNLNWI 205
++ E R + + + + A + + Y L I L++I
Sbjct: 148 EVDGFIAALQEIRTLLNQQTITDGRQALPYQLTIAGAGGAFFLSRYYSKLAQIVAPLDYI 207
Query: 206 HAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGY 265
+ +T P T AAL+G +G + G+
Sbjct: 208 NLMTYDLAGPWE-KVTNHQAALFGDAAGP------------------TFYNALREANLGW 248
Query: 266 AWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGT 325
+W + + A ++ H+ G +
Sbjct: 249 SWEELTRAFPSPFSLTVDAA-----------VQQHLMMEGV-------------PSAKIV 284
Query: 326 VWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQA 368
+ FDD E+ + K Y K+++L G W + D+ + L A
Sbjct: 285 MGVPFDDAESFKYKAKYIKQQQLGGVMFWHLGQDNRNGDLLAA 327
|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Length = 73 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 570 | |||
| d2pi6a1 | 292 | Signal processing protein (SPC-40, MGP-40) {Sheep | 100.0 | |
| d1itxa1 | 347 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 100.0 | |
| d1kfwa1 | 374 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 100.0 | |
| d1wb0a1 | 297 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d1w9pa1 | 333 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 100.0 | |
| d1edqa2 | 358 | Chitinase A, catalytic domain {Serratia marcescens | 100.0 | |
| d1vf8a1 | 302 | Chitinase-like lectin ym1, saccharide binding doma | 100.0 | |
| d1ll7a1 | 330 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 100.0 | |
| d1jnda1 | 327 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 100.0 | |
| d1goia2 | 356 | Chitinase B, catalytic domain {Serratia marcescens | 100.0 | |
| d1nara_ | 289 | Seed storage protein {Vicia narbonensis, Narbonin | 99.97 | |
| d1edta_ | 265 | Endo-beta-N-acetylglucosaminidase {Streptomyces pl | 99.95 | |
| d2hvma_ | 273 | Hevamine A (chitinase/lysozyme) {Para rubber tree | 99.95 | |
| d2ebna_ | 285 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.94 | |
| d1ta3a_ | 274 | Xylanase inhibitor protein I, XIP-I {Wheat (Tritic | 99.92 | |
| d1cnva_ | 283 | Seed storage protein {Jack bean (Canavalia ensifor | 99.91 | |
| d1eoka_ | 282 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.78 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.57 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.56 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.55 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.52 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.52 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.52 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.51 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.5 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.5 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.5 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.49 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.49 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.47 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.47 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.47 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.46 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.45 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.45 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.44 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.43 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.43 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.42 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.42 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.42 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.41 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.4 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.4 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.4 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.38 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.37 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.36 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.36 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.35 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.34 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.34 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.3 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.3 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.29 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.26 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.26 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.25 | |
| d1vf8a2 | 70 | Chitinase-like lectin ym1 {Mouse (Mus musculus) [T | 99.25 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.24 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.24 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 99.23 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.18 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.17 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.1 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.09 | |
| d1wb0a2 | 68 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 99.08 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.08 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.07 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.07 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.03 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.02 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.01 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.01 | |
| d2pi6a2 | 68 | Signal processing protein (SPC-40, MGP-40) {Sheep | 98.99 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 98.91 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 98.89 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 98.81 | |
| d1itxa2 | 72 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 98.7 | |
| d1edqa3 | 73 | Chitinase A {Serratia marcescens [TaxId: 615]} | 98.68 | |
| d1kfwa2 | 61 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 98.65 | |
| d1jnda2 | 92 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 98.49 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 98.14 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 98.09 | |
| d1goia3 | 88 | Chitinase B {Serratia marcescens [TaxId: 615]} | 97.64 | |
| d1w9pa2 | 62 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 97.37 | |
| d1ll7a2 | 62 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 97.34 | |
| d1j7la_ | 263 | Type IIIa 3',5"-aminoglycoside phosphotransferase | 89.44 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 85.26 |
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Type II chitinase domain: Signal processing protein (SPC-40, MGP-40) species: Sheep (Ovis aries) [TaxId: 9940]
Probab=100.00 E-value=2.4e-55 Score=430.61 Aligned_cols=261 Identities=25% Similarity=0.356 Sum_probs=218.9
Q ss_pred eEEEEEecCCC-------CCcCCCCCCCCcceEEEEeEEEeCCceEEeeCCCccHHHHHHHHHHHHhhCCCceEEEEEcC
Q 008332 26 WIRVGYLNLSE-------VSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQ 98 (570)
Q Consensus 26 ~~vvgY~~~~~-------~~~~~~i~~~~~Thii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lk~~~~~~kvllsigg 98 (570)
.+|||||++|+ .+.+++||+++||||+|+|+.+++++. ......+...+.++ ..+|+++|++|+++||||
T Consensus 1 ~kvv~Yy~~w~~~r~~~~~~~~~~i~~~~~THiiyafa~i~~~~~--~~~~~~~~~~~~~~-~~lk~~~~~lKvllSvGG 77 (292)
T d2pi6a1 1 YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYTFANISNNEI--DTWEWNDVTLYDTL-NTLKNRNPKLKTLLSVGG 77 (292)
T ss_dssp CEEEEEEEGGGGGSSGGGCCCGGGSCTTTCSEEEEEEEEEETTEE--ECCSTTHHHHHHHH-HHHHHHCTTCEEEEEEET
T ss_pred CeEEEEEccccccCCCCCCCChhHCCcccCCEEEEEEEEecCCCc--eecccccHHHHHHH-HHHHhhCCCceEEEEEec
Confidence 47999999985 357999999999999999999998753 22223344555555 569999999999999999
Q ss_pred CCCCCcccccccccChHHHHHHHHHHHHHHHHcCCCceeeeccCCCCCCCccchhhhHHHHHHHHhhhhhcccccccceE
Q 008332 99 GKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLL 178 (570)
Q Consensus 99 ~~~~~~~~f~~~~~~~~~r~~fi~siv~~~~~~~~DGidiDwE~p~~~~~~~~~~~l~~~lr~~l~~~~~~~~~~~~~~~ 178 (570)
|+. ++..|+.+++++++|++||+++++++++|+|||||||||+|+ ..++.+|+.|++++|.+|.+..... ...+
T Consensus 78 ~~~-~~~~fs~~~~~~~~r~~fi~si~~~l~~~~fDGiDiDwE~p~-~~~~~~~~~l~~~lr~~l~~~~~~~----~~~~ 151 (292)
T d2pi6a1 78 WNF-GPERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPG-RRDKRHLTTLVKEMKAEFIREAQAG----TEQL 151 (292)
T ss_dssp TTS-CHHHHHHHHTSHHHHHHHHHHHHHHHHHHTCSEEEEECSCCC-GGGHHHHHHHHHHHHHHHHHHHTTS----SCCC
T ss_pred ccc-CchHHHHHhccHHHHHHHHHHHHHHHHhcCCCeEEEeccccc-cccccccchhHHHHHHHHHHHHhcc----CCCc
Confidence 865 556799999999999999999999999999999999999994 5788899999999999997543322 2334
Q ss_pred EEEeecccCCC--CCccChHHHhhhhceeeeecccCCCCCCCCCCCCCCCCCCCCCCC--CccCHHHHHHHHHHcCCCCC
Q 008332 179 ILTARFRYSPP--ANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGR--FARSTDQVLKAWIERGLSAD 254 (570)
Q Consensus 179 ~~~~~~~~~~~--~~~~~~~~l~~~vD~i~vm~yd~~~~~~~~~~~~~a~l~~~~~~~--~~~~v~~~v~~~~~~gvp~~ 254 (570)
.++++++..+. ...|++.++.+++||||+|+||++++|. ..+|++|||+...... ...+++.+|++|++.|+|++
T Consensus 152 ~~s~~~~~~~~~~~~~~~~~~l~~~vD~invMtYD~~g~~~-~~~g~~apL~~~~~~~~~~~~~v~~~v~~~~~~Gvp~~ 230 (292)
T d2pi6a1 152 LLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWR-QTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPAN 230 (292)
T ss_dssp EEEEEEECCHHHHHHHCCHHHHHHHCSEEEEETTCCSCTTC-CBCCCSSCSSCCSSSCSCTTSSHHHHHHHHHHTTCCGG
T ss_pred ceecccCchhhHHhccccHHHHHhhCCEEEEecccccCCCC-CccccCCCCCCCCcccCcCCccHHHHHHHHHHCCCCHH
Confidence 45554444332 3578999999999999999999999987 4699999999765432 23589999999999999999
Q ss_pred ceeeeccccccceeccCCCCCCCCCCCCCCCCCCCCcccHHHHHHHHhhCCCCeEEeecCceEEEEeecCCEEEeccCHH
Q 008332 255 KLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVE 334 (570)
Q Consensus 255 KlvlGip~yG~~~~~~~~~~~~~g~~~~g~~~~~~g~~~y~~i~~~~~~~~~~~~~~~d~~~~~~y~~~~~~~i~ydd~~ 334 (570)
||+|||| |||++
T Consensus 231 KlvlGip--------------------------------------------------------------------ydd~~ 242 (292)
T d2pi6a1 231 KLVMGIP--------------------------------------------------------------------TDDQE 242 (292)
T ss_dssp GEEEEEE--------------------------------------------------------------------SCCHH
T ss_pred HeEEEec--------------------------------------------------------------------CCCHH
Confidence 9999986 69999
Q ss_pred HHHHHHHhhhccCCceEEEEEccccChhhH
Q 008332 335 AVRAKIAYAKEKRLLGYYAWQVSFDDHDWL 364 (570)
Q Consensus 335 Si~~K~~~~~~~gLgGv~~W~l~~Dd~~~~ 364 (570)
|++.|++|++++||||+|+|++++||++.+
T Consensus 243 Si~~K~~~~~~~~lgGv~iW~l~~DD~~G~ 272 (292)
T d2pi6a1 243 SVKNKARYLKNRQLAGAMVWALDLDDFRGT 272 (292)
T ss_dssp HHHHHHHHHHHTTCSEEEEECGGGSCSSSC
T ss_pred HHHHHHHHHHHCCCceEEEEecccccCCCC
Confidence 999999999999999999999999998753
|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|