Citrus Sinensis ID: 008348

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------57
MAFWGVEVKPGKPFTHTADDVRGRLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGASGQRYNLNDELESYGEDIADTETERSTGHSDEDKYDDSFINDADLDIIPPSPVSGGGGSHRRLRKNYQLIESDDDVSAQKQMLADGSTAAAASDGESEDMQPISSLCKVSSDKQENIETREINVRKSGGTSTDEAKDEGNCFILSEERSDDDVNGEPKRSDMCDSVLPSAEVGLENGAKPKKKKKVQSKEGTQVEEKGLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVNNAKPKKRKRKEQQKSLEADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEKKKKKKKRRTEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
ccEEEEEEccccccccccccccccEEEEEEEEcccccccccEEEEEccccccEEEEEEccccccEEEEEEEEccccEEEEEEEcccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHcccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHcccccccccccccHHHHHHcccccccccHHHHHHcHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEcccccEEEEEEEccccccccccccEEEEEEEEEEcccccEEccccccccEEEEcccccccccHHHHHcccccccEEEEEEccccccccccccccccccccEEEEEEEEEEEcc
ccEEEEEEcccccccccccccccEEEEEEEEccccccccEEEEEEEccccccEEEEEEccccEEEccEEEEEEcccEEEEEEEcccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccEEEccccccHHHHHHHcccccccEEEEccccccccccccccccHHHccccHHHHHHHcccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccHcccEEEccccEEEEccccccccccccccccccccccccccccccccEcccccccccccccccccccHHHccccccHEEcccHHccccccHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEEHHHccccEEEEcccccccHHHHHHHcccccccEEEEEEcHHHccccccEHHHcccccccEEEEEEEEEEcc
mafwgvevkpgkpfthtaddvrgrlhisqatlgigtapkksvvqcnvgdkspvflcslfpekaescqlnlefeeadEVVFsvigpqsvhltgyflgasgqrynlndelesygediadteterstghsdedkyddsfindadldiippspvsggggshrrlrknyqliesdDDVSAQKQMLADgstaaaasdgesedmqpisslckvssdkqenietreinvrksggtstdeakdegncfilseersdddvngepkrsdmcdsvlpsaevglengakpkkkkkvqskegtqveekglqndtetdkiiqnlpvpneenqktsnhvenvgsvnnakpkkrkRKEQQKsleadsvdctnvikgdkalhdevkhdrmgqdtpgrveqneqqvtdvipgndvdqsvaelqpekkkkkkkrrteedgkdsnmethplsmdamsgsvmvtenssaegKLSLLrtlpnglviqklgtgkpdgkvaapgkkISVLYTGklkengqvfdsnlgstplkfhlggkeVIEGLNVglegmhvgekrrllippslgygsggddsknippyswlefDVDLVKVHR
mafwgvevkpgkpfthtaddvrGRLHISQAtlgigtapkKSVVQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGASGQRYNLNDELESYGEDIAdteterstghsdedkyDDSFINdadldiippspvsggggshrRLRKNYQLIESDDDVSAQKQMLADGSTAaaasdgesedmqpisslckvssdkqenietreinvrksggtstdeakdegncfilseersdddvngepKRSDMCDSVLPSaevglengakpkkkkkvqskegtqveekglqndtetdkiiqnlpvpneenqktsnhvenvgsvnnakpkkrkrkeqqksleadsvdctnvikgdkalhdevkhdrmgqdtpgrveQNEQQvtdvipgndvdqsvaelqpekkkkkkkrrteedgkdsnmethplsmdAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKlgtgkpdgkvaapGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPslgygsggddsknippyswlefdvDLVKVHR
MAFWGVEVKPGKPFTHTADDVRGRLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGASGQRYNLNDELESYGEDIADTETERSTGHSDEDKYDDSFINDADLDIIppspvsggggsHRRLRKNYQLIESDDDVSAQKQMLadgstaaaasdgesedMQPISSLCKVSSDKQENIETREINVRKSGGTSTDEAKDEGNCFILSEERSDDDVNGEPKRSDMCDSVLPSAEVGLENGAkpkkkkkVQSKEGTQVEEKGLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVNNAkpkkrkrkeqqkSLEADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEkkkkkkkRRTEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
***WGVEVK**KPFTHTADDVRGRLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGASGQRYNLN***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************LLRTLPNGLVIQKLGTG*****VAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYG*******NIPPYSWLEFDVDLVK***
MAFWGVEVKPGKPFTHTADDVRGRLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGAS************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************NGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
MAFWGVEVKPGKPFTHTADDVRGRLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGASGQRYNLNDELESYGEDIAD************DKYDDSFINDADLDIIPPSP*********RLRKNYQLIESD******************************SSLCKVSSDKQENIETREINV************DEGNCFILSEE****************DSVLPSAEVGLENG********************GLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVN*****************ADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAEL*********************METHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
*AFWGVEVKPGKPFTHTADDVRGRLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGAS********************************KYDDSFINDADLDIIPPS******GSHRRLRKNYQLIESDDD**AQKQ*LADGSTAAAASDG***D*QPI************************************NCFI**EERSD*********************************KKVQSKEGTQVEEKG*******************************************************VDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEKKKKKKKRRTEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFWGVEVKPGKPFTHTADDVRGRLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGASGQRYNLNDELESYGEDIADTETERSTGHSDEDKYDDSFINDADLDIIPPSPVSGGGGSHRRLRKNYQLIESDDDVSAQKQMLADGSTAAAASDGESEDMQPISSLCKVSSDKQENIETREINVRKSGGTSTDEAKDEGNCFILSEERSDDDVNGEPKRSDMCDSVLPSAEVGLENGAKPKKKKKVQSKEGTQVEEKGLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVNNAKPKKRKRKEQQKSLEADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEKKKKKKKRRTEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query569 2.2.26 [Sep-21-2011]
Q93ZG9477 Peptidyl-prolyl cis-trans yes no 0.240 0.287 0.521 3e-35
F4J9Q6499 Peptidyl-prolyl cis-trans no no 0.198 0.226 0.570 6e-33
Q9FLB3143 Peptidyl-prolyl cis-trans no no 0.219 0.874 0.492 7e-27
P0CP98405 FK506-binding protein 4 O yes no 0.203 0.286 0.454 9e-18
P0CP99405 FK506-binding protein 4 O N/A no 0.203 0.286 0.454 9e-18
P54397357 39 kDa FK506-binding nucl yes no 0.195 0.310 0.464 1e-17
Q26486412 46 kDa FK506-binding nucl N/A no 0.193 0.266 0.433 2e-17
Q6FSC1136 FK506-binding protein 2 O yes no 0.163 0.683 0.526 3e-17
Q6BSE7437 FK506-binding protein 3 O yes no 0.189 0.247 0.442 2e-16
Q54NB6364 FK506-binding protein 4 O yes no 0.184 0.288 0.481 2e-16
>sp|Q93ZG9|FKB53_ARATH Peptidyl-prolyl cis-trans isomerase FKBP53 OS=Arabidopsis thaliana GN=FKBP53 PE=1 SV=1 Back     alignment and function desciption
 Score =  150 bits (378), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 98/138 (71%), Gaps = 1/138 (0%)

Query: 431 SMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKL 490
           S +A   S  V + + A+ K S +RT PNGL++++L  GKP+GK A PGK +SV Y GKL
Sbjct: 341 SDEAAEISGTVEKQTPADSKSSQVRTYPNGLIVEELSMGKPNGKRADPGKTVSVRYIGKL 400

Query: 491 KENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSK 550
           ++NG++FDSN+G +P KF LG   VI+G +VG+ GM VG+KR+L IPPS+GYG  G   +
Sbjct: 401 QKNGKIFDSNIGKSPFKFRLGIGSVIKGWDVGVNGMRVGDKRKLTIPPSMGYGVKGAGGQ 460

Query: 551 NIPPYSWLEFDVDLVKVH 568
            IPP SWL FDV+L+ V 
Sbjct: 461 -IPPNSWLTFDVELINVQ 477
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Histone chaperone possibly involved in H3/H4 deposition to the nucleosome. Associates with 18S rDNA chromatin and negatively regulates the level of its expression.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|F4J9Q6|FKB43_ARATH Peptidyl-prolyl cis-trans isomerase FKBP43 OS=Arabidopsis thaliana GN=FKBP43 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB3|FK153_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-3 OS=Arabidopsis thaliana GN=FKBP15-3 PE=2 SV=1 Back     alignment and function description
>sp|P0CP98|FKBP4_CRYNJ FK506-binding protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR4 PE=3 SV=1 Back     alignment and function description
>sp|P0CP99|FKBP4_CRYNB FK506-binding protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR4 PE=3 SV=1 Back     alignment and function description
>sp|P54397|FKB39_DROME 39 kDa FK506-binding nuclear protein OS=Drosophila melanogaster GN=FK506-bp1 PE=1 SV=2 Back     alignment and function description
>sp|Q26486|FKBP4_SPOFR 46 kDa FK506-binding nuclear protein OS=Spodoptera frugiperda GN=FKBP46 PE=2 SV=1 Back     alignment and function description
>sp|Q6FSC1|FKBP2_CANGA FK506-binding protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q6BSE7|FKBP3_DEBHA FK506-binding protein 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR3 PE=3 SV=1 Back     alignment and function description
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query569
224097319570 predicted protein [Populus trichocarpa] 0.564 0.563 0.462 5e-72
255546850584 Caldesmon, putative [Ricinus communis] g 0.671 0.654 0.445 2e-71
225455553525 PREDICTED: uncharacterized protein LOC10 0.866 0.939 0.370 2e-70
449454516481 PREDICTED: uncharacterized protein LOC10 0.356 0.422 0.585 2e-65
357470491 870 FK506-binding protein [Medicago truncatu 0.347 0.227 0.536 3e-54
388507688353 unknown [Lotus japonicus] 0.463 0.747 0.423 8e-47
225462092555 PREDICTED: uncharacterized protein LOC10 0.381 0.390 0.504 1e-45
356497385503 PREDICTED: uncharacterized protein LOC10 0.267 0.302 0.551 2e-40
356538942503 PREDICTED: uncharacterized protein LOC10 0.267 0.302 0.551 3e-40
449499693471 PREDICTED: peptidyl-prolyl cis-trans iso 0.358 0.433 0.421 2e-39
>gi|224097319|ref|XP_002310907.1| predicted protein [Populus trichocarpa] gi|222853810|gb|EEE91357.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  278 bits (712), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 230/378 (60%), Gaps = 57/378 (15%)

Query: 1   MAFWGVEVKPGKPFTHTADDVRGRLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSLFP 60
           MAFWGVEVKPGKPF H  ++ R RLHISQATLG G++ K SVVQCNVG+ SPV+LCSLFP
Sbjct: 1   MAFWGVEVKPGKPFIHAPNNGR-RLHISQATLGTGSSMKNSVVQCNVGNSSPVYLCSLFP 59

Query: 61  EKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGA-SGQRYNLNDELESYGEDIADTE 119
           EK E  QL+LEFEE  EVVFSVIGP+SVHLTGY+LG   GQ ++ +DE ESYGEDIADTE
Sbjct: 60  EKTEISQLHLEFEETVEVVFSVIGPRSVHLTGYYLGGRCGQHFHPDDETESYGEDIADTE 119

Query: 120 TERSTGHSDEDKYDDSFIN-DADLDIIPPSPV--------------SGGGGSHRRLRKNY 164
           TERS   SDED+Y+ SFIN D D +I+ PS V                G GSH+RLRK +
Sbjct: 120 TERSANGSDEDEYEGSFINDDEDPEIMSPSTVYSSEVEEIFDKKKRKNGKGSHKRLRKKF 179

Query: 165 QLIESDDDVSAQKQMLADGSTAAAASDGESEDMQPISSLC-KVSSDKQENIETREINVRK 223
           Q IESDD                       ED  PIS L  + S+ K    E  E   ++
Sbjct: 180 QFIESDD-----------------------EDKMPISFLHERESAVKSMGSEAGEKCEKE 216

Query: 224 SGGTSTDEAKDEGNCFILSEERSDDDVNGEPKRSDMCDSVLPSAEVGLENGAKPKKKKKV 283
            G TS  + KD GN   +S+  +   +    ++ D   S LPS+++G +NGAKPKKK + 
Sbjct: 217 KGETSEKKVKDNGNWVTVSKGNAGAILGVSKRQIDDHHSFLPSSDMGSQNGAKPKKKGEK 276

Query: 284 QSKEGTQVE-----------EKGLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVNNA 332
             +E   +E           +K +Q++ E DK+  +LPV  +E+QKT+N      +V   
Sbjct: 277 HYREEVPLEDDFFFCRALGQQKSIQSEVEADKLDLDLPV-TKEDQKTTND----KNVEKL 331

Query: 333 KPKKRKRKEQQKSLEADS 350
           K +++K  ++++SL+AD+
Sbjct: 332 KRRRKKYAKEKESLDADN 349

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546850|ref|XP_002514483.1| Caldesmon, putative [Ricinus communis] gi|223546382|gb|EEF47883.1| Caldesmon, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225455553|ref|XP_002268439.1| PREDICTED: uncharacterized protein LOC100258340 [Vitis vinifera] gi|296084130|emb|CBI24518.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454516|ref|XP_004145000.1| PREDICTED: uncharacterized protein LOC101206226 [Cucumis sativus] gi|449472960|ref|XP_004153744.1| PREDICTED: uncharacterized protein LOC101209576 [Cucumis sativus] gi|449498886|ref|XP_004160661.1| PREDICTED: uncharacterized LOC101209576 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357470491|ref|XP_003605530.1| FK506-binding protein [Medicago truncatula] gi|355506585|gb|AES87727.1| FK506-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388507688|gb|AFK41910.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225462092|ref|XP_002271499.1| PREDICTED: uncharacterized protein LOC100267010 [Vitis vinifera] gi|296086769|emb|CBI32918.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497385|ref|XP_003517541.1| PREDICTED: uncharacterized protein LOC100789099 [Glycine max] Back     alignment and taxonomy information
>gi|356538942|ref|XP_003537959.1| PREDICTED: uncharacterized protein LOC100792856 [Glycine max] Back     alignment and taxonomy information
>gi|449499693|ref|XP_004160889.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query569
TAIR|locus:2092467499 AT3G12340 "AT3G12340" [Arabido 0.242 0.276 0.666 2.5e-81
TAIR|locus:2138029477 FKBP53 "AT4G25340" [Arabidopsi 0.479 0.572 0.333 2e-69
UNIPROTKB|Q0J2V8416 Os09g0293900 "Peptidyl-prolyl 0.251 0.343 0.527 4.2e-55
UNIPROTKB|Q7XUX5525 OSJNBa0027P08.21 "Peptidyl-pro 0.347 0.377 0.373 8.4e-54
TAIR|locus:2153519143 AT5G05420 "AT5G05420" [Arabido 0.219 0.874 0.492 6.3e-28
DICTYBASE|DDB_G0285357364 DDB_G0285357 "FKBP-type peptid 0.339 0.530 0.336 1e-26
UNIPROTKB|A8JAS8104 FKB53 "Peptidyl-prolyl cis-tra 0.181 0.990 0.533 1.8e-23
POMBASE|SPBC1347.02361 fkbp39 "FKBP-type peptidyl-pro 0.239 0.376 0.388 1.1e-21
CGD|CAL0001110426 orf19.1030 [Candida albicans ( 0.189 0.253 0.424 1.4e-20
UNIPROTKB|G4MKI9485 MGG_04476 "Peptidyl-prolyl cis 0.209 0.245 0.452 4.8e-19
TAIR|locus:2092467 AT3G12340 "AT3G12340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 474 (171.9 bits), Expect = 2.5e-81, Sum P(2) = 2.5e-81
 Identities = 96/144 (66%), Positives = 113/144 (78%)

Query:     1 MAFWGVEVKPGKPFTHTADDVRG--RLHISQATLGIGTAPKKSVVQCNVGDKSPVFLCSL 58
             MAFWGVEVKPGK FT   ++  G  RLH+SQATLG GTA  +S++QCNVG+KSP+ LC L
Sbjct:     1 MAFWGVEVKPGKTFTLKNNEATGIRRLHLSQATLGHGTATNRSILQCNVGNKSPLLLCVL 60

Query:    59 FPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFLGAS-GQRYNLNDELESYGEDIAD 117
              P+K +SCQLNLEFEE DEV+FSVIGP+SVHLTGYFLG S G R N +DE ES+GEDI D
Sbjct:    61 TPDKVDSCQLNLEFEETDEVIFSVIGPRSVHLTGYFLGRSTGFRPN-DDESESFGEDIVD 119

Query:   118 TETERSTGHSDEDKYDDSFINDAD 141
             T+ E+  G SD+  Y DSFIND D
Sbjct:   120 TDMEK--GSSDDYDYSDSFINDDD 141
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=IEA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0042991 "transcription factor import into nucleus" evidence=RCA
TAIR|locus:2138029 FKBP53 "AT4G25340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0J2V8 Os09g0293900 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XUX5 OSJNBa0027P08.21 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2153519 AT5G05420 "AT5G05420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285357 DDB_G0285357 "FKBP-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|A8JAS8 FKB53 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
POMBASE|SPBC1347.02 fkbp39 "FKBP-type peptidyl-prolyl cis-trans isomerase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0001110 orf19.1030 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|G4MKI9 MGG_04476 "Peptidyl-prolyl cis-trans isomerase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_VII001324
hypothetical protein (570 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query569
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 7e-28
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 1e-24
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 1e-11
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 2e-08
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 1e-06
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score =  106 bits (268), Expect = 7e-28
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 2/93 (2%)

Query: 474 KVAAPGKKISVLYTGKLKENGQVFDSNLG-STPLKFHLGGKEVIEGLNVGLEGMHVGEKR 532
           + A  G  ++V YTGKL E+G VFDS+     P +F LG  +VI G + GL GM VGEKR
Sbjct: 3   EKAKKGDTVTVHYTGKL-EDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGEKR 61

Query: 533 RLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLV 565
           +L IPP L YG  G     IPP + L F+V+L+
Sbjct: 62  KLTIPPELAYGEEGLAGGVIPPNATLVFEVELL 94

Length = 94
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 569
PF03066149 Nucleoplasmin: Nucleoplasmin; InterPro: IPR004301 99.95
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.93
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.89
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.89
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.88
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.88
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.87
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.84
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.75
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.47
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.44
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.34
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.34
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 98.77
PRK01490 435 tig trigger factor; Provisional 98.69
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.52
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.44
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 96.51
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.32
PF10446458 DUF2457: Protein of unknown function (DUF2457); In 91.21
PF10446458 DUF2457: Protein of unknown function (DUF2457); In 80.47
>PF03066 Nucleoplasmin: Nucleoplasmin; InterPro: IPR004301 The nucleophosmin/nucleoplasmin family of chaperones includes nucleophosmin, nucleoplasmin and nucleoplasmin-like proteins Back     alignment and domain information 
Probab=99.95  E-value=4.6e-28  Score=227.26  Aligned_cols=98  Identities=31%  Similarity=0.461  Sum_probs=80.6

Q ss_pred             cEEEEEEcCCC-ceEeec-CC--CCceEEEEEEEeCCCCCCCceEEEEEe----CCCccEEEEeeCCCCcceeeeceeec
Q 008348            2 AFWGVEVKPGK-PFTHTA-DD--VRGRLHISQATLGIGTAPKKSVVQCNV----GDKSPVFLCSLFPEKAESCQLNLEFE   73 (569)
Q Consensus         2 ~FwG~eVkpgk-~~~~~~-~d--~~~~LhLsqasLg~~~~~e~~~V~v~v----~~~~~v~L~tL~~~~~eqvsLDL~F~   73 (569)
                      .||||+|++++ .|+|.+ ++  ..++|||+|||||+++++++|+|+|..    +...+|+||||+++.++||+|++ |.
T Consensus         5 ~~wGceL~~~k~~~~f~~~~~d~~~h~L~L~~v~Lga~AKdE~~vVe~e~~~~eg~~~kv~lAtLk~s~~~~vsL~~-~~   83 (149)
T PF03066_consen    5 YFWGCELKADKKDYTFKVDDNDENEHQLSLRQVCLGAGAKDELNVVEVEAMNYEGKPIKVPLATLKMSVQPMVSLDG-FE   83 (149)
T ss_dssp             EEEEEEEBSTB-EEEE-TTSSSSSCEEEEEEEEEE-TTS-SSEEEEEEEEEBTTSCEEEEEEEEEBTTTBSEEEEEE-EE
T ss_pred             EEEEEEEcCCCceEEEeCCCCCCcccEEEEEEeecCCCccCceeEEEEEeccCCCCeeEEEEEEecCCccceEEcCC-cc
Confidence            69999999997 899999 22  256999999999999999999999997    44467999999999999999996 44


Q ss_pred             CCCcEEEEEE-cCceEEEeeeeeccCCC
Q 008348           74 EADEVVFSVI-GPQSVHLTGYFLGASGQ  100 (569)
Q Consensus        74 ~~~~V~f~~~-GsgsVHLsGY~~~~~~~  100 (569)
                      .+++|+|+|+ |+|||||||||++...+
T Consensus        84 ~~ppVtf~L~~GsGPVhisG~~~~~~~~  111 (149)
T PF03066_consen   84 ITPPVTFRLKCGSGPVHISGQHLVAMEE  111 (149)
T ss_dssp             ESSSEEEEEEESSS-EEEEEEEEEE---
T ss_pred             cCCCEEEEEEecCCCEEeeCcccccccc
Confidence            5778999998 99999999999877544

They function as nuclear chaperones which are needed for the proper assembly of nucleosomes and the attainment of proper higher order chromatin structures [].; GO: 0003676 nucleic acid binding; PDB: 2P1B_E 1XB9_I 1XE0_C 1NLQ_A 2VTX_E 1K5J_D 1EJY_N 1EE5_B 3T30_J.
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query569
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-13
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-13
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-13
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-13
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 6e-13
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-12
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 1e-12
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 1e-12
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 2e-12
2pbc_A102 Fk506-Binding Protein 2 Length = 102 3e-11
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 7e-11
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 8e-11
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 1e-10
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 1e-10
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 2e-10
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 3e-10
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 3e-10
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 3e-10
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 4e-10
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 4e-10
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 5e-10
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 6e-10
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 8e-10
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 2e-09
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 2e-09
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-09
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 3e-09
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 3e-09
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 4e-09
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 1e-08
2ki3_A126 Structural And Biochemical Characterization Of Fk50 1e-08
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 1e-08
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 3e-08
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 3e-08
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 1e-07
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-07
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-07
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 3e-07
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 4e-07
1q1c_A 280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 7e-07
3oe2_A219 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran 1e-06
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 2e-06
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 2e-06
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 7e-06
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure 
Iteration: 1

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 69/117 (58%), Gaps = 5/117 (4%)
Query: 452 SLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGST-PLKFHL 510
           S + T  +GL  + L  G   G  A  G+ +SV YTG L  +GQ FDS+     P  F L
Sbjct: 97  STVVTTESGLKYEDLTEGS--GAEARAGQTVSVHYTGWLT-DGQKFDSSKDRNDPFAFVL 153
Query: 511 GGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKV 567
           GG  VI+G + G++GM VG  RRL IPP LGYG+ G  +  IPP + L F+V+L+ V
Sbjct: 154 GGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARG-AAGVIPPNATLVFEVELLDV 209
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query569
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 3e-36
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 7e-32
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 2e-31
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 5e-31
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 6e-31
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 7e-31
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 9e-31
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 1e-30
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 2e-30
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 3e-30
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 7e-30
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 5e-29
2ppn_A107 FK506-binding protein 1A; high resolution protein 8e-29
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 1e-28
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-28
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-28
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 5e-27
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 8e-26
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 1e-24
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 3e-24
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-21
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-20
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-24
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-19
1fd9_A213 Protein (macrophage infectivity potentiator prote; 1e-23
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-22
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 1e-22
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-18
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-16
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 3e-15
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 7e-13
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 1e-12
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 3e-12
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 8e-12
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-10
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 2e-10
1nlq_A108 Nucleoplasmin-like protein; DNLP, chaperone, histo 2e-10
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 2e-10
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 3e-09
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
 Score =  130 bits (329), Expect = 3e-36
 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 5/117 (4%)

Query: 456 TLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLG---STPLKFHLGG 512
                + I+ L       +    G  + V Y G L+++G +F S        P+ F LG 
Sbjct: 9   IPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGI 68

Query: 513 KEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR 569
            E ++G + GL+GM VGEKR+L+IPP+LGYG  G     IPP S L F++DL+++  
Sbjct: 69  LEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEG--KGKIPPESTLIFNIDLLEIRN 123
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>1nlq_A Nucleoplasmin-like protein; DNLP, chaperone, histone binding, X-RAY crystallography, ligand binding; 1.50A {Drosophila melanogaster} SCOP: b.121.3.1 Length = 108 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query569
1nlq_A108 Nucleoplasmin-like protein; DNLP, chaperone, histo 99.93
1xe0_A114 Nucleophosmin; drosophila nucleoplasmin-like prote 99.92
1k5j_A124 Nucleoplasmin core; beta-barrel, jellyroll, beta-b 99.9
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.89
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.89
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.89
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.89
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.89
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.89
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.88
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.88
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.88
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.87
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.87
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.87
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.87
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.87
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.87
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.87
3t30_B110 Nucleoplasmin-2; beta-barrel jelly roll topology, 99.86
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.86
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.86
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.86
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.86
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.84
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.83
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.82
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.79
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.76
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.75
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.75
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.73
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.68
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.55
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.53
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.5
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.49
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.49
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.48
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.48
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.48
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.44
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.31
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.23
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.06
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.05
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 97.6
>1nlq_A Nucleoplasmin-like protein; DNLP, chaperone, histone binding, X-RAY crystallography, ligand binding; 1.50A {Drosophila melanogaster} SCOP: b.121.3.1 Back     alignment and structure
Probab=99.93  E-value=6.9e-26  Score=200.31  Aligned_cols=95  Identities=24%  Similarity=0.373  Sum_probs=87.4

Q ss_pred             cEEEEEEcCCC-ceEeecCCC---CceEEEEEEEeCCCCC-CCceEEEEEe-CCCccEEEEeeCCCCcceeeeceeecCC
Q 008348            2 AFWGVEVKPGK-PFTHTADDV---RGRLHISQATLGIGTA-PKKSVVQCNV-GDKSPVFLCSLFPEKAESCQLNLEFEEA   75 (569)
Q Consensus         2 ~FwG~eVkpgk-~~~~~~~d~---~~~LhLsqasLg~~~~-~e~~~V~v~v-~~~~~v~L~tL~~~~~eqvsLDL~F~~~   75 (569)
                      .||||+|++++ +|+|+++++   +++|||+|||||++++ +++++|+|+. +++.+++||||+++++|||+|+|.|. +
T Consensus         5 ~fwG~eLk~~k~~~~f~~~~d~~~eh~L~L~~a~LG~~aK~dE~~vVev~~~~~~~kv~LatLk~~~~~~~~l~l~f~-~   83 (108)
T 1nlq_A            5 SFYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEVNTPKDSVQIPIAVLKAGETRAVNPDVEFY-E   83 (108)
T ss_dssp             EEEEEEECSTTCEEEECTTSSCCSCCEEEEEEEEECTTSCBTCEEEEEEEEGGGTEEEEEEEEEBTTBSEECCCEEEE-S
T ss_pred             eEEEEEEcCCCceeEECCCCCcCcccEEEEEEEEcCCCccCCCcEEEEEEeCCCCcEEEEEEECCCCcceEecceEEe-C
Confidence            69999999996 999999874   5799999999999988 8999999998 66778999999999999999999997 5


Q ss_pred             CcEEEEEE-cCceEEEeeeeecc
Q 008348           76 DEVVFSVI-GPQSVHLTGYFLGA   97 (569)
Q Consensus        76 ~~V~f~~~-GsgsVHLsGY~~~~   97 (569)
                      ++|+|+++ |+|||||||||+.+
T Consensus        84 ~pVtf~L~~GsGPVhisG~h~~~  106 (108)
T 1nlq_A           84 SKVTFKLIKGSGPVYIHGHNIKD  106 (108)
T ss_dssp             SCEEEEEEESCCCEEEEEEEECC
T ss_pred             CCEEEEEEecCCCEEEEeEEEec
Confidence            67999998 99999999999864
>1xe0_A Nucleophosmin; drosophila nucleoplasmin-like protein (DNLP), nucleoplasmin (NP), histone binding, X-RAY crystallography, chaperone; 1.70A {Xenopus laevis} SCOP: b.121.3.1 PDB: 1xb9_A 2p1b_A Back     alignment and structure
>1k5j_A Nucleoplasmin core; beta-barrel, jellyroll, beta-bulge, pentamer, chaperone; 2.30A {Xenopus laevis} SCOP: b.121.3.1 PDB: 2vtx_A 2vtx_J Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3t30_B Nucleoplasmin-2; beta-barrel jelly roll topology, histone chaperone, H2A-H2B H3-H4 tetramer, oocytes and early embryos, chaperone; 1.90A {Homo sapiens} SCOP: b.121.3.0 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 569
d1nlqa_105 b.121.3.1 (A:) Chromatin decondensation protein 1 2e-22
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-18
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-16
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-15
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 2e-15
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 3e-15
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 7e-15
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 9e-15
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-13
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 2e-13
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 4e-13
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-12
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 2e-12
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 6e-09
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 4e-07
>d1nlqa_ b.121.3.1 (A:) Chromatin decondensation protein 1 (Crp1, Nlp) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 105 Back     information, alignment and structure

class: All beta proteins
fold: Nucleoplasmin-like/VP (viral coat and capsid proteins)
superfamily: Nucleoplasmin-like core domain
family: Nucleoplasmin-like core domain
domain: Chromatin decondensation protein 1 (Crp1, Nlp)
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 90.4 bits (224), Expect = 2e-22
 Identities = 19/99 (19%), Positives = 37/99 (37%), Gaps = 6/99 (6%)

Query: 3   FWGVEVKPGKPFTH----TADDVRGRLHISQATLGIGTAP-KKSVVQCNV-GDKSPVFLC 56
           F+GV +                   +L I Q  LG      + +VV+ N   D   + + 
Sbjct: 4   FYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEVNTPKDSVQIPIA 63

Query: 57  SLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYFL 95
            L   +  +   ++EF E+      + G   V++ G+ +
Sbjct: 64  VLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNI 102
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query569
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.92
d1nlqa_105 Chromatin decondensation protein 1 (Crp1, Nlp) {Fr 99.91
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.91
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.9
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.9
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.9
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.89
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.89
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.89
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.87
d1xe0a_108 Nucleophosmin (NO38) {African clawed frog (Xenopus 99.87
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1k5ja_105 Nucleoplasmin core {Xenopus laevis [TaxId: 8355]} 99.86
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.85
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.8
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.43
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.42
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.94
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.85
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Macrophage infectivity potentiator protein (MIP)
species: Legionella pneumophila [TaxId: 446]

Probab=99.92  E-value=2.4e-25  Score=214.77  Aligned_cols=120  Identities=28%  Similarity=0.505  Sum_probs=110.8

Q ss_pred             CcccccccCCeEeCCCceEEEEEeecCCCCccCCCCCEEEEEEEEEEccCCcEEecCCCC-cCeEEEeCCcchhccHHHH
Q 008348          444 NSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGS-TPLKFHLGGKEVIEGLNVG  522 (569)
Q Consensus       444 ~~~~~~k~~~~~t~~sGl~y~il~~G~~~G~~~~~GD~VtVhYtg~~~~dG~v~dST~~~-~P~~f~LG~g~lipGleea  522 (569)
                      ..+++++...++++++||+|++++.|  .|..|..||.|.|||++++ .||++|++++.+ .|+.|.+  +.+||||++|
T Consensus        83 fl~~~~~~~~v~~~~sGl~y~v~~~G--~G~~p~~~d~v~v~y~g~l-~dg~~f~~s~~~~~p~~~~~--~~~i~G~~e~  157 (204)
T d1fd9a_          83 FLTENKNKPGVVVLPSGLQYKVINSG--NGVKPGKSDTVTVEYTGRL-IDGTVFDSTEKTGKPATFQV--SQVIPGWTEA  157 (204)
T ss_dssp             HHHHHHHSTTEEECTTSCEEEEEECC--CSCCCCTTCEEEEEEEEEE-TTSCEEEEHHHHCSCEEEEG--GGSCHHHHHH
T ss_pred             HHHhcccCCceEEecCccEEEEeecC--CCcccCCCCEEEEEEEEEE-CCCCEecccccCCCCceecC--CccchhHHHH
Confidence            34567778899999999999999999  7999999999999999999 899999998754 7888877  5799999999


Q ss_pred             HcCCccCcEEEEEEcCCCCCCCCCCCCCCCCCCCeEEEEEEEeEEeC
Q 008348          523 LEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR  569 (569)
Q Consensus       523 L~gMkvGek~~V~VPpelaYG~~G~~~~~IPpnstLvfeVELl~Vkk  569 (569)
                      |.+|++|++++|+|||++|||..|.++. ||||++|+|+|+|++|++
T Consensus       158 l~~m~~G~~~~~~iP~~laYG~~g~~~~-Ipp~s~l~feveL~~i~k  203 (204)
T d1fd9a_         158 LQLMPAGSTWEIYVPSGLAYGPRSVGGP-IGPNETLIFKIHLISVKK  203 (204)
T ss_dssp             HTTCCTTCEEEEEECGGGTTTTCCCSSS-CCTTCCEEEEEEEEEEEC
T ss_pred             hcCCCCCCEEEEEEChHHCcCCCCCCCC-cCcCCcEEEEEEEEEEEc
Confidence            9999999999999999999999998876 999999999999999986
>d1nlqa_ b.121.3.1 (A:) Chromatin decondensation protein 1 (Crp1, Nlp) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xe0a_ b.121.3.1 (A:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5ja_ b.121.3.1 (A:) Nucleoplasmin core {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure