Citrus Sinensis ID: 008400


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------
MDEDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMKSRAQGGRAHERRQQGMTEV
ccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEccccccccEEEECccccccHHHHHHHHccccccEEEEEEcccccccccccccccccccCEEEEEEEccccccccccccccEEEEEEEccccccccccccEEEEEEEEEEcccCEECccccEEEEEccccccHHHHHHHHccccccEEEEEEccccccccccccccccccccccccHHHHHHHHHccccEEEEcccccEEEEEEEccccccccccccEEEEEEEEECccccEEECcccccccCEEEEEcccccccHHHHHHHHccccccEEEEEEccccccccccccccccccccccEEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccccc
****FDI*************************EIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFG************VPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQ*ELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGD****QAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYG**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDxxxxxxxxxxxxxxxxxxxxxEAKFYGNMFAKMKSRAQGGRAHERRQQGMTEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase FKBP62 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Co-chaperone that positively modulates thermotolerance by interacting with HSP90.1 and increasing the HSFA2-mediated accumulation of chaperones of the small-HSPs family.confidentQ38931
70 kDa peptidyl-prolyl isomerase PPIases accelerate the folding of proteins during protein synthesis.probableQ43207
Peptidyl-prolyl cis-trans isomerase FKBP65 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Co-chaperone that negatively modulates thermotolerance by interacting with FKBP62 and decreasing the HSFA2-mediated accumulation of chaperones of the small-HSPs family. Plays a positive role in tolerance to intracellular acid stress by maintaining the pH homeostasis.probableQ9FJL3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JXV, chain A
Confidence level:very confident
Coverage over the Query: 144-383
View the alignment between query and template
View the model in PyMOL
Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 399-546
View the alignment between query and template
View the model in PyMOL
Template: 1P5Q, chain A
Confidence level:very confident
Coverage over the Query: 267-554
View the alignment between query and template
View the model in PyMOL