Citrus Sinensis ID: 008421

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------
MGGEEGTSNGDTEWLKREELNNGCGVRIEHDFFYGSSSLGEGFRTYKRRKHANSSSEGKSLEDWTASVETADKNTEQNFRDVVLEHLYQSFSDDEGGVQGCIREALLSHPEMDRATTVKGLNTLHEDRKKCLQTGIHNGTQYLTKGHVGVISDGPLHRSDRRTNTDMCQRAFLEIITSEKFTLLCKVLLGNFQGIKVDRVFNLSAINSRMKQGAYENSPMQFMADVQQVWKKFQEIGAEIITLAKKLSELSQASYIEHVGGSAPCSYDERKNELSTMEPDSVVKVEQTAACDVYKVHTCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAGDEICPANGETSTEFEENSNCTTANVDKPTDNGVDSRESANLCKICGRKVEESSDKFRSCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDAGIQEIRRVKKAYMHKRKKQDEEESDKGRGGMDMLLTAARTLNFQEMAAIDGSR
ccccccccccccHHHHHHHHccccccccccccccccccccccccEEEcccccccccccccccccccHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccc
ccccccccccccccccHHHccccccccEEcccccccccccHHHHHHHHHccccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccEccccccccccccccccccccccHHHHccccccHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHccccccccccccEEcHEHccccccccccEHHHcccccccccEEEEccccccccccccccccccccccccEcccccEccccccccccHHHHccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccEEEHHcccccccccEEEEccccccEEEEccccccccccccccEcccEEHHHHcccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccc
mggeegtsngdteWLKREelnngcgvriehdffygssslgegfrtykrrkhansssegksleDWTASVETADKNTEQNFRDVVLEHLYqsfsddeggvqGCIREAllshpemdrattVKGLNTLHEDRKKCLQTgihngtqyltkghvgvisdgplhrsdrrtnTDMCQRAFLEIITSEKFTLLCKVLLGnfqgikvdRVFNLSAINSRmkqgayenspmQFMADVQQVWKKFQEIGAEIITLAKKLSELSQASYiehvggsapcsyderknelstmepdsvvKVEQTAAcdvykvhtcrqceekagekdglvcdsceemyhlsciepafkdippkswycarctakgfgsphenCIVCERmnanapriqinqagdeicpangetstefeensncttanvdkptdngvdsresaNLCKICgrkveessdkfrscehafcyskfyhercltpkqlkrygpcwfcpsclcracltdkddekivmcdgcdqgyhlycmdpprtsvpkgnwfcrkcDAGIQEIRRVKKAYMHKrkkqdeeesdkgrggMDMLLTAARTLNFQEMAAIDGSR
mggeegtsngdtewLKREELNNGCGVRIEHDFFYGSSSLGEGFRTYKRrkhansssegksledWTASVETADKNTEQNFRDVVLEHLYQsfsddeggVQGCIREAllshpemdraTTVKGLNTLHEDRKKCLQTGIHNGTQYLTKGHVGVISDGPLHRSDRRTNTDMCQRAFLEIITSEKFTLLCKVLLGNFQGIKVDRVFNLSAINSRMKQGAYENSPMQFMADVQQVWKKFQEIGAEIITLAKKLSELSQASYIEHVGGSAPCSYDERKNELSTMEPDSVVKVEQTAACDVYKVHTCRQCeekagekdglvcDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAGDEICPANGETStefeensncttanvdkptdngvdsresanlCKICGRKveessdkfrsCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDAGIQEIRRVKKaymhkrkkqdeeesdkgrggMDMLLTAArtlnfqemaaidgsr
MGGEEGTSNGDTEWLKREELNNGCGVRIEHDFFYGSSSLGEGFRTYKRRKHANSSSEGKSLEDWTASVETADKNTEQNFRDVVLEHLYQSFSDDEGGVQGCIREALLSHPEMDRATTVKGLNTLHEDRKKCLQTGIHNGTQYLTKGHVGVISDGPLHRSDRRTNTDMCQRAFLEIITSEKFTLLCKVLLGNFQGIKVDRVFNLSAINSRMKQGAYENSPMQFMADVQQVWKKFQEIGAEIITLAKKLSELSQASYIEHVGGSAPCSYDERKNELSTMEPDSVVKVEQTAACDVYKVHTCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAGDEICPANGETSTEFEENSNCTTANVDKPTDNGVDSRESANLCKICGRKVEESSDKFRSCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDAGIQEIRRVKKAYMHKRKKQDEEESDKGRGGMDMLLTAARTLNFQEMAAIDGSR
**************LKREELNNGCGVRIEHDFFYGSSSLG**************************************FRDVVLEHLYQSFSDDEGGVQGCIREALLSHPEMDRATTVKGLNTLHEDRKKCLQTGIHNGTQYLTKGHVGVISDGPLH****RTNTDMCQRAFLEIITSEKFTLLCKVLLGNFQGIKVDRVFNLSAINSRMKQGAYENSPMQFMADVQQVWKKFQEIGAEIITLAKKLSELSQASYIEHVGG********************VVKVEQTAACDVYKVHTCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQIN*******************************************LCKICGRKVE***DKFRSCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDAGIQEIRRVKKAY*****************************************
**************LKREELNNGCGVRIEHDF*****S**************************************QNFRDVVLEH**********G**GCIREALLSHPEMDRA************************************************NTDMCQRAFLEIITSEKFTLLCKVLLGNFQGIKVDRVFNLSAINSR***********QFMADVQQVWKKFQEIGAEIIT************************************************CDVYKVHTCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAGDEICPANGETSTEFEENSNCTTANVDKPTDNGVDSRESANLCKICGR******DKFRSCEHAFCYSKFYHERCLT**********WFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCD******************************************************
**********DTEWLKREELNNGCGVRIEHDFFYGSSSLGEGFRTY*******************ASVETADKNTEQNFRDVVLEHLYQSFSDDEGGVQGCIREALLSHPEMDRATTVKGLNTLHEDRKKCLQTGIHNGTQYLTKGHVGVISDGPLHRSDRRTNTDMCQRAFLEIITSEKFTLLCKVLLGNFQGIKVDRVFNLSAINSRMKQGAYENSPMQFMADVQQVWKKFQEIGAEIITLAKKLSELSQASYIEHVGGSAPCSYDERKNELSTMEPDSVVKVEQTAACDVYKVHTCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAGDEICPANG***********CTTANVDKPTDNGVDSRESANLCKICGRKVEESSDKFRSCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDAGIQEIRRVKK*****************RGGMDMLLTAARTLNFQEMAAIDGSR
************EWLKREELNNGCGVRIEHDFFYGSSSLGEGFRTYKRRKHANSSSEGKS*************NTEQNFRDVVLEHLYQSFSDDEGGVQGCIREALLSHPEMDRATTVKGLNTLH**RKKCLQT*******Y*******************RTNTDMCQRAFLEIITSEKFTLLCKVLLGNFQGIKVDRVFNLSAINSRMKQGAYENSPMQFMADVQQVWKKFQEIGAEIITLAKKLSELSQASYIEHVG*************LSTMEPDSVVKVEQTAACDVYKVHTCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAGDEICPANGETSTEFEENSNCTTANV****DNGVDSRESANLCKICGRKVEESSDKFRSCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDAGIQEIRRVKKAYMHKRKKQDEEESDKGRGGMDMLLTAARTLNFQEMAA*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGEEGTSNGDTEWLKREELNNGCGVRIEHDFFYGSSSLGEGFRTYKRRKHANSSSEGKSLEDWTASVETADKNTEQNFRDVVLEHLYQSFSDDEGGVQGCIREALLSHPEMDRATTVKGLNTLHEDRKKCLQTGIHNGTQYLTKGHVGVISDGPLHRSDRRTNTDMCQRAFLEIITSEKFTLLCKVLLGNFQGIKVDRVFNLSAINSRMKQGAYENSPMQFMADVQQVWKKFQEIGAEIITLAKKLSELSQASYIEHVGGSAPCSYDERKNELSTMEPDSVVKVEQTAACDVYKVHTCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAGDEICPANGETSTEFEENSNCTTANVDKPTDNGVDSRESANLCKICGRKVEESSDKFRSCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDAGIQEIRRVKKAYMHKRKKQDEEESDKGRGGMDMLLTAARTLNFQEMAAIDGSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query566 2.2.26 [Sep-21-2011]
Q6PDK2 5588 Histone-lysine N-methyltr yes no 0.151 0.015 0.357 9e-13
O14686 5537 Histone-lysine N-methyltr yes no 0.151 0.015 0.368 1e-12
Q9SGH2 2176 Methyl-CpG-binding domain no no 0.143 0.037 0.329 2e-11
Q8NEZ4 4911 Histone-lysine N-methyltr no no 0.160 0.018 0.390 8e-11
Q8BRH4 4903 Histone-lysine N-methyltr no no 0.160 0.018 0.390 1e-10
P41230 1554 Lysine-specific demethyla no no 0.111 0.040 0.415 6e-10
Q38JA7 1556 Lysine-specific demethyla no no 0.111 0.040 0.415 6e-10
P41229 1560 Lysine-specific demethyla no no 0.111 0.040 0.415 7e-10
A1YVX4 1516 Lysine-specific demethyla no no 0.111 0.041 0.415 7e-10
Q9UIF8 2168 Bromodomain adjacent to z no no 0.273 0.071 0.284 9e-10
>sp|Q6PDK2|MLL2_MOUSE Histone-lysine N-methyltransferase MLL2 OS=Mus musculus GN=Mll2 PE=1 SV=2 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 49/95 (51%), Gaps = 9/95 (9%)

Query: 433 CEHAFCYS--KFYHERCLTPKQLKRYGPCWFCPSC-LCRACLTDKDDEKIVMCDGCDQGY 489
           C+  FC S    YH  CL      R    W CP C +C++C    +D K+++C+ CD+GY
Sbjct: 239 CDLLFCTSCGHHYHGACLDTALTARKRASWQCPECKVCQSCRKPGNDSKMLVCETCDKGY 298

Query: 490 HLYCMDPPRTSVPKGNW------FCRKCDAGIQEI 518
           H +C+ PP   +P  +W       CR C AG  E+
Sbjct: 299 HTFCLKPPMEDLPAHSWKCKTCRLCRACGAGSAEL 333
Histone methyltransferase. Methylates 'Lys-4' of histone H3 (H3K4me). H3K4me represents a specific tag for epigenetic transcriptional activation. Plays a central role in beta-globin locus transcription regulation by being recruited by NFE2. Acts as a coactivator for estrogen receptor by being recruited by ESR1, thereby activating transcription (By similarity). Plays an important role in controlling bulk H3K4me during oocyte growth and preimplantation development. Required during the transcriptionally active period of oocyte growth for the establishment and/or maintenance of bulk H3K4 trimethylation (H3K4me3), global transcriptional silencing that preceeds resumption of meiosis, oocyte survival and normal zygotic genome activation.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 3
>sp|O14686|MLL2_HUMAN Histone-lysine N-methyltransferase MLL2 OS=Homo sapiens GN=MLL2 PE=1 SV=2 Back     alignment and function description
>sp|Q9SGH2|MBD9_ARATH Methyl-CpG-binding domain-containing protein 9 OS=Arabidopsis thaliana GN=MBD9 PE=2 SV=1 Back     alignment and function description
>sp|Q8NEZ4|MLL3_HUMAN Histone-lysine N-methyltransferase MLL3 OS=Homo sapiens GN=MLL3 PE=1 SV=3 Back     alignment and function description
>sp|Q8BRH4|MLL3_MOUSE Histone-lysine N-methyltransferase MLL3 OS=Mus musculus GN=Mll3 PE=2 SV=2 Back     alignment and function description
>sp|P41230|KDM5C_MOUSE Lysine-specific demethylase 5C OS=Mus musculus GN=Kdm5c PE=2 SV=4 Back     alignment and function description
>sp|Q38JA7|KDM5C_CANFA Lysine-specific demethylase 5C OS=Canis familiaris GN=KDM5C PE=2 SV=1 Back     alignment and function description
>sp|P41229|KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens GN=KDM5C PE=1 SV=2 Back     alignment and function description
>sp|A1YVX4|KDM5C_PIG Lysine-specific demethylase 5C OS=Sus scrofa GN=KDM5C PE=2 SV=1 Back     alignment and function description
>sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
302141752 795 unnamed protein product [Vitis vinifera] 0.867 0.617 0.515 1e-145
224066781604 predicted protein [Populus trichocarpa] 0.922 0.864 0.464 1e-137
356518577646 PREDICTED: uncharacterized protein LOC10 0.904 0.792 0.461 1e-133
224082358524 predicted protein [Populus trichocarpa] 0.849 0.917 0.458 1e-127
356554670 832 PREDICTED: uncharacterized protein LOC10 0.908 0.617 0.452 1e-126
449444070574 PREDICTED: uncharacterized protein LOC10 0.911 0.898 0.427 1e-120
356551207525 PREDICTED: uncharacterized protein LOC10 0.819 0.883 0.472 1e-119
359492251386 PREDICTED: uncharacterized protein LOC10 0.666 0.976 0.546 1e-117
255558536510 DNA binding protein, putative [Ricinus c 0.818 0.907 0.458 1e-117
449523423576 PREDICTED: uncharacterized LOC101205573, 0.818 0.803 0.435 1e-107
>gi|302141752|emb|CBI18955.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  522 bits (1344), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 264/512 (51%), Positives = 348/512 (67%), Gaps = 21/512 (4%)

Query: 63  DWTASVETADKNTEQNFRDVVLEHLYQSFSDDEGGVQGCIREALLSHPEMDRATTVKGLN 122
           D  A V   D + +Q++R++VL+ +Y+S SD EGG++GC+R ALLS PE+D  TT+K   
Sbjct: 297 DHHAIVNGLDDSPQQHWRNIVLDQMYRSLSDSEGGIRGCVRAALLSCPEVDHTTTIKKPV 356

Query: 123 TLHEDRKKCLQTGIHNGTQYLTKGHVGVISDGPLHRSDRRTNTDMCQRAFLEIITSEKFT 182
             H+D +    TG+    +  ++ HVGV S+G L  SD  T T++C+R+F ++I SEKF 
Sbjct: 357 HFHKDVRCPPHTGLLP-NESASRSHVGVTSNGSLSESDHHTITELCRRSFFKLIMSEKFA 415

Query: 183 LLCKVLLGNFQGIKVDRVFNLSAINSRMKQGAYENSPMQFMADVQQVWKKFQEIGAEIIT 242
            LCK++L NFQGIKVD  F+ S I+SRM +GAYE SPM F +DVQQVWKK Q IG EI++
Sbjct: 416 SLCKLMLENFQGIKVDNFFDFSLIHSRMIEGAYERSPMLFSSDVQQVWKKLQRIGTEIVS 475

Query: 243 LAKKLSELSQASYIEHVGGSAPCSYDERKNELSTMEPDSVVKVEQTAACDVYKVHTCRQC 302
           L   LSE+S+ SY E V G+   + ++ KNE+ T E DS  K+EQ  AC V+KV +CR C
Sbjct: 476 LGTTLSEMSRTSYSELVEGAVLSASEDGKNEVCTRESDSHTKLEQLVACGVFKVCSCRHC 535

Query: 303 EEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMN 362
            EKA  +D LVCDSCEE+YH+SC+EPA K IP KSWYC  C A     PHENC+VC+++N
Sbjct: 536 GEKADGRDCLVCDSCEEVYHISCVEPAVKVIPHKSWYCVDCIASRL--PHENCVVCKKLN 593

Query: 363 ANAPRIQINQAGDEICPANGETSTEFEENSNCTTANVDKPTDNGVDSRESA---NLCKIC 419
           A   R  IN  GD+I   N ET  E EE+SNC        T+ G+  ++      LCKIC
Sbjct: 594 AQ--RTLINGVGDDIISMNEETDMELEESSNCI-------TEVGIQQQKETKYFQLCKIC 644

Query: 420 GRKVEESSDKFRSCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKI 479
           G  + E  +    C H FC +K+YH+ CLT  +L+ YGPCW+CPSCLCRACLTD+DDEKI
Sbjct: 645 GSDM-EFGEHLLECGHPFCPNKYYHKSCLTSTELRMYGPCWYCPSCLCRACLTDRDDEKI 703

Query: 480 VMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDAGIQEIRRVKKAY---MHKRKKQDEEE 536
           ++CDGCD  YH+YCM+PPRTS+P+G WFCRKCDA IQ+IR+ K  +     +RK++ E+ 
Sbjct: 704 ILCDGCDHAYHIYCMNPPRTSIPRGKWFCRKCDADIQKIRKAKMVFEDLERERKQKGEQV 763

Query: 537 SDKG-RGGMDMLLTAARTLNFQ-EMAAIDGSR 566
            DK   G MD+LL AA+TLN Q E+AAI   R
Sbjct: 764 IDKDEEGPMDILLNAAQTLNLQEELAAIRMDR 795

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224066781|ref|XP_002302212.1| predicted protein [Populus trichocarpa] gi|222843938|gb|EEE81485.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356518577|ref|XP_003527955.1| PREDICTED: uncharacterized protein LOC100795906 [Glycine max] Back     alignment and taxonomy information
>gi|224082358|ref|XP_002306661.1| predicted protein [Populus trichocarpa] gi|222856110|gb|EEE93657.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356554670|ref|XP_003545667.1| PREDICTED: uncharacterized protein LOC100810450 [Glycine max] Back     alignment and taxonomy information
>gi|449444070|ref|XP_004139798.1| PREDICTED: uncharacterized protein LOC101205573 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356551207|ref|XP_003543969.1| PREDICTED: uncharacterized protein LOC100786712 [Glycine max] Back     alignment and taxonomy information
>gi|359492251|ref|XP_002284634.2| PREDICTED: uncharacterized protein LOC100247132 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255558536|ref|XP_002520293.1| DNA binding protein, putative [Ricinus communis] gi|223540512|gb|EEF42079.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449523423|ref|XP_004168723.1| PREDICTED: uncharacterized LOC101205573, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
TAIR|locus:2195945522 AT1G77250 "AT1G77250" [Arabido 0.466 0.505 0.458 2e-71
UNIPROTKB|F1NW66 4880 Gga.49064 "Uncharacterized pro 0.254 0.029 0.315 2.3e-11
UNIPROTKB|J9NSP5 4515 MLL2 "Uncharacterized protein" 0.242 0.030 0.295 2.7e-17
ZFIN|ZDB-GENE-060223-2 4967 mll2 "myeloid/lymphoid or mixe 0.206 0.023 0.333 4.8e-17
MGI|MGI:2682319 5588 Mll2 "myeloid/lymphoid or mixe 0.242 0.024 0.302 1.4e-16
UNIPROTKB|G3MZF2 5420 MLL2 "Uncharacterized protein" 0.242 0.025 0.295 5.3e-16
UNIPROTKB|E1B9N8 5448 MLL2 "Uncharacterized protein" 0.242 0.025 0.295 5.4e-16
UNIPROTKB|O14686 5537 MLL2 "Histone-lysine N-methylt 0.242 0.024 0.302 7e-16
UNIPROTKB|E2RQ26 5563 MLL2 "Uncharacterized protein" 0.242 0.024 0.295 9.2e-16
UNIPROTKB|J9P0X8 5671 MLL2 "Uncharacterized protein" 0.242 0.024 0.295 9.8e-16
TAIR|locus:2195945 AT1G77250 "AT1G77250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 672 (241.6 bits), Expect = 2.0e-71, Sum P(2) = 2.0e-71
 Identities = 126/275 (45%), Positives = 166/275 (60%)

Query:   266 SYDERKNELSTMEPDSVVKVEQTAACDVYKVHTCRQCEEKAGEKDGLVCDSCEEMYHLSC 325
             SY E+  +  T E       E      V  +  C+ C EKA  +D L CD CE+MYH+SC
Sbjct:   212 SYKEQLKQFYTGESKPCPNAENIRNDSVSDI--CKLCGEKAEARDCLACDHCEDMYHVSC 269

Query:   326 IEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAGDEICPANGETS 385
              +P  K +P  SWYC  CT+KG GSPHENC+VCE+M         N++ D       E S
Sbjct:   270 AQPGGKGMPTHSWYCLDCTSKGIGSPHENCVVCEKMKTQGMMKTDNRSVDTSTECK-EDS 328

Query:   386 TEFEENSNCTTANVDKPTDNGVDSRESANLCKICGRKVEESSDKFRSCEHAFCYSKFYHE 445
              E EENS+C   N++    +   SR+S  LC+ CG KV+ S  K+ +C+H FC  K+YH 
Sbjct:   329 NESEENSSC---NMNHEVHHVEMSRDS-ELCRTCGTKVD-SGGKYITCDHPFCPHKYYHI 383

Query:   446 RCLTPKQLKRYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGN 505
             RCLT +Q+K +G  W+C SCLCR CLTDKDD+KIV+CDGCD  YH+YCM PP  SVP G 
Sbjct:   384 RCLTSRQIKLHGVRWYCSSCLCRNCLTDKDDDKIVLCDGCDDAYHIYCMRPPCESVPNGE 443

Query:   506 WFCRKCDAGIQEIRRVKKAYMHKRKKQDEEESDKG 540
             WFC  C A I ++++ +KA+    KK +  +  KG
Sbjct:   444 WFCTACKAAILKVQKARKAF---EKKMETVQKQKG 475
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|F1NW66 Gga.49064 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSP5 MLL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060223-2 mll2 "myeloid/lymphoid or mixed-lineage leukemia 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2682319 Mll2 "myeloid/lymphoid or mixed-lineage leukemia 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZF2 MLL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1B9N8 MLL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O14686 MLL2 "Histone-lysine N-methyltransferase MLL2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQ26 MLL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0X8 MLL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_II000707
hypothetical protein (604 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
pfam0062851 pfam00628, PHD, PHD-finger 2e-10
smart0024947 smart00249, PHD, PHD zinc finger 4e-08
COG5141 669 COG5141, COG5141, PHD zinc finger-containing prote 7e-06
pfam0062851 pfam00628, PHD, PHD-finger 3e-05
smart0024947 smart00249, PHD, PHD zinc finger 2e-04
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 0.002
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 56.0 bits (135), Expect = 2e-10
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 467 CRACLTDKDDEKIVMCDGCDQGYHLYCMDPP--RTSVPKGNWFCRKCDAG 514
           C  C    DD ++++CDGCD+ +HL C+ PP     +P+G W+C +C   
Sbjct: 2   CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKPK 51

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 566
KOG1244336 consensus Predicted transcription factor Requiem/N 99.52
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 99.07
KOG1512381 consensus PHD Zn-finger protein [General function 99.04
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 99.03
KOG0954 893 consensus PHD finger protein [General function pre 99.03
KOG0956 900 consensus PHD finger protein AF10 [General functio 99.0
COG5141 669 PHD zinc finger-containing protein [General functi 98.95
KOG0957 707 consensus PHD finger protein [General function pre 98.93
KOG4299613 consensus PHD Zn-finger protein [General function 98.89
KOG4299 613 consensus PHD Zn-finger protein [General function 98.85
KOG1244336 consensus Predicted transcription factor Requiem/N 98.67
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.6
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.56
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.47
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 98.42
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.38
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.34
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 98.33
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 98.32
KOG0383 696 consensus Predicted helicase [General function pre 98.32
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.31
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 98.21
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 98.19
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 98.19
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 98.15
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 98.14
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 98.13
KOG1474640 consensus Transcription initiation factor TFIID, s 98.1
KOG0383 696 consensus Predicted helicase [General function pre 98.09
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 98.08
KOG1512381 consensus PHD Zn-finger protein [General function 98.07
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 98.07
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 98.06
KOG0957707 consensus PHD finger protein [General function pre 98.02
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 97.98
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 97.98
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 97.97
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 97.96
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 97.94
KOG1973274 consensus Chromatin remodeling protein, contains P 97.94
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 97.93
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 97.93
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 97.89
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 97.85
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 97.81
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 97.8
smart00297107 BROMO bromo domain. 97.79
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 97.76
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 97.75
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 97.73
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 97.73
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 97.71
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 97.71
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 97.7
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 97.69
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 97.68
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 97.56
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 97.54
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 97.53
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.52
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 97.43
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.42
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.4
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 97.36
KOG1973274 consensus Chromatin remodeling protein, contains P 97.34
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 97.26
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 97.13
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 97.1
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 97.08
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.01
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 96.63
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 96.61
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.49
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 95.85
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 95.45
COG5076371 Transcription factor involved in chromatin remodel 93.98
KOG0954 893 consensus PHD finger protein [General function pre 93.75
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 92.65
COG5141 669 PHD zinc finger-containing protein [General functi 92.57
KOG0956 900 consensus PHD finger protein AF10 [General functio 92.45
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 91.81
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 91.34
KOG1246 904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 89.98
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 87.04
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 86.18
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 84.54
KOG1246 904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 83.57
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 81.39
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information 
Probab=99.52  E-value=1.9e-15  Score=149.40  Aligned_cols=100  Identities=32%  Similarity=0.892  Sum_probs=83.5

Q ss_pred             cccccccccCcccccC-----CCcccccCCccCCCccccccCCCccc--c-ccCCCCccCCCc-ccccccccCCCCceee
Q 008421          411 ESANLCKICGRKVEES-----SDKFRSCEHAFCYSKFYHERCLTPKQ--L-KRYGPCWFCPSC-LCRACLTDKDDEKIVM  481 (566)
Q Consensus       411 ~~~~~C~~Cgs~~~~~-----~~~Ll~C~~~~C~~k~yH~~CL~~~~--~-~~~~~~w~Cp~C-~C~~C~~~~~~~~ll~  481 (566)
                      .+.++|.+|......+     .+.|+.|+.  | ++..|++||.-+.  + ......|+|.+| .|.+|+.+..+++||+
T Consensus       222 ~Pn~YCDFclgdsr~nkkt~~peelvscsd--c-grsghpsclqft~nm~~avk~yrwqcieck~csicgtsenddqllf  298 (336)
T KOG1244|consen  222 QPNPYCDFCLGDSRENKKTGMPEELVSCSD--C-GRSGHPSCLQFTANMIAAVKTYRWQCIECKYCSICGTSENDDQLLF  298 (336)
T ss_pred             cCCcccceeccccccccccCCchhhcchhh--c-CCCCCcchhhhhHHHHHHHHhheeeeeecceeccccCcCCCceeEe
Confidence            4667888887543221     567999986  8 8999999996532  2 223458999999 7999999999999999


Q ss_pred             ccCCCCCCcCCCCCCCCCCCCCCCcccCCCcc
Q 008421          482 CDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDA  513 (566)
Q Consensus       482 Cd~C~~~~H~~Cl~Ppl~~~p~~~W~C~~C~~  513 (566)
                      ||.|++.|||+||.||+..+|.|.|.|..|..
T Consensus       299 cddcdrgyhmyclsppm~eppegswsc~KOG~  330 (336)
T KOG1244|consen  299 CDDCDRGYHMYCLSPPMVEPPEGSWSCHLCLE  330 (336)
T ss_pred             ecccCCceeeEecCCCcCCCCCCchhHHHHHH
Confidence            99999999999999999999999999999964

>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
2ysm_A111 Solution Structure Of The First And Second Phd Doma 1e-09
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 3e-09
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 2e-08
4gy5_A241 Crystal Structure Of The Tandem Tudor Domain And Pl 2e-08
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 3e-08
3zvy_A72 Phd Finger Of Human Uhrf1 In Complex With Unmodifie 5e-07
3shb_A77 Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 5e-07
3t6r_A72 Structure Of Uhrf1 In Complex With Unmodified H3 N- 6e-07
3sou_A70 Structure Of Uhrf1 Phd Finger In Complex With Histo 6e-07
3zvz_B57 Phd Finger Of Human Uhrf1 Length = 57 6e-07
2lgg_A69 Structure Of Phd Domain Of Uhrf1 In Complex With H3 7e-07
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 2e-06
2ln0_A110 Structure Of Moz Length = 110 3e-06
3v43_A112 Crystal Structure Of Moz Length = 112 3e-06
2puy_A60 Crystal Structure Of The Bhc80 Phd Finger Length = 4e-06
2yql_A56 Solution Structure Of The Phd Domain In Phd Finger 8e-06
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 1e-05
1f62_A51 Wstf-Phd Length = 51 1e-05
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 1e-05
2e6s_A77 Solution Structure Of The Phd Domain In Ring Finger 1e-04
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 5e-04
1mm3_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 5e-04
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure 
Iteration: 1

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 11/85 (12%)
Query: 434 EHAFCYS--KFYHERCL----TPKQLKRYGPCWFCPSC-LCRACLTDKDDEKIVMCDGCD 486
           +  FC +  + YH  CL    TP  LKR G  W CP C +C+ C    +D K+++CD CD
Sbjct: 21  DQFFCTTCGQHYHGMCLDIAVTP--LKRAG--WQCPECKVCQNCKQSGEDSKMLVCDTCD 76
Query: 487 QGYHLYCMDPPRTSVPKGNWFCRKC 511
           +GYH +C+ P   SVP   W C+ C
Sbjct: 77  KGYHTFCLQPVMKSVPTNGWKCKNC 101
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 Back     alignment and structure
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 Back     alignment and structure
>pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 Back     alignment and structure
>pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 Back     alignment and structure
>pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 Back     alignment and structure
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 Back     alignment and structure
>pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure
>pdb|2E6S|A Chain A, Solution Structure Of The Phd Domain In Ring Finger Protein 107 Length = 77 Back     alignment and structure
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure
>pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-21
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 5e-10
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 3e-07
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 9e-06
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 4e-21
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 2e-07
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 2e-20
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 2e-08
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 5e-20
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 4e-09
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 1e-19
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 1e-08
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 2e-19
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 2e-07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-19
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 1e-07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 4e-06
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 5e-19
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 3e-07
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 9e-19
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 3e-09
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 2e-13
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 2e-07
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 4e-13
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 2e-07
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 4e-13
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 3e-07
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 1e-12
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 3e-07
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 3e-12
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-06
2k16_A75 Transcription initiation factor TFIID subunit 3; p 4e-12
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-06
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 4e-12
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 3e-06
2yt5_A66 Metal-response element-binding transcription facto 2e-11
2yt5_A66 Metal-response element-binding transcription facto 4e-05
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 2e-11
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 2e-05
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 1e-10
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 8e-04
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 1e-09
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 9e-04
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 4e-09
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-05
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 5e-08
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 9e-05
1x4i_A70 Inhibitor of growth protein 3; structural genomics 1e-05
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-05
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 4e-05
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 5e-05
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 6e-05
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 6e-04
1wee_A72 PHD finger family protein; structural genomics, PH 8e-04
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 8e-04
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 9e-04
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 9e-04
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
 Score = 89.3 bits (221), Expect = 1e-21
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 6/104 (5%)

Query: 409 SRESANLCKICGRKVEESSDKFRSCEHAFCYSKFYHERCLTPKQLKRYGPCWFCPSC-LC 467
           S  S   C +C    +        C       + YH  CL           W CP C +C
Sbjct: 3   SGSSGANCAVCDSPGDL--LDQFFCTTC---GQHYHGMCLDIAVTPLKRAGWQCPECKVC 57

Query: 468 RACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKC 511
           + C    +D K+++CD CD+GYH +C+ P   SVP   W C+ C
Sbjct: 58  QNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNC 101
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.78
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.67
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.67
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.45
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.43
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.42
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.36
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.33
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.32
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.31
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.3
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.3
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.28
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.27
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.27
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.25
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.25
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.24
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.23
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.22
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.19
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.19
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.18
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.17
2yt5_A66 Metal-response element-binding transcription facto 99.16
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.15
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.11
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.07
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.06
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.05
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.04
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.04
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.02
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.02
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.99
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.98
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.97
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.97
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.95
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.94
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.94
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.91
2yt5_A66 Metal-response element-binding transcription facto 98.84
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.8
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.79
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.76
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.73
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.73
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.7
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.69
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.69
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.68
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.67
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.66
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.66
1weu_A91 Inhibitor of growth family, member 4; structural g 98.64
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.6
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.49
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 98.47
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 98.44
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 98.4
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 98.37
2dat_A123 Possible global transcription activator SNF2L2; br 98.37
3uv4_A158 Second bromodomain of human transcription initiat 98.37
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 98.37
2grc_A129 Probable global transcription activator SNF2L4; br 98.36
3d7c_A112 General control of amino acid synthesis protein 5; 98.32
3nxb_A116 CAT eye syndrome critical region protein 2; struct 98.32
3fkm_X166 Signaling protein; bromodomain, malaria, structura 98.31
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 98.28
3p1f_A119 CREB-binding protein; structural genomics consorti 98.27
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 98.27
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 98.27
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.26
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 98.24
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 98.23
4alg_A154 Bromodomain-containing protein 2; signaling protei 98.23
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 98.22
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.21
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.2
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 98.18
2d9e_A121 Peregrin; four-helix bundle, transcription activat 98.18
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.17
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 98.17
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 98.17
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 98.16
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.15
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.15
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.14
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.13
1weu_A91 Inhibitor of growth family, member 4; structural g 98.12
3rcw_A135 Bromodomain-containing protein 1; transcription, s 98.11
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.08
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 98.07
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 98.07
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.06
1we9_A64 PHD finger family protein; structural genomics, PH 97.98
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.96
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.93
1wew_A78 DNA-binding family protein; structural genomics, P 97.89
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.88
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.87
3dai_A130 ATPase family AAA domain-containing protein 2; anc 97.86
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.84
1wee_A72 PHD finger family protein; structural genomics, PH 97.81
1wem_A76 Death associated transcription factor 1; structura 97.8
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.79
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.75
1we9_A64 PHD finger family protein; structural genomics, PH 97.72
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.68
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.66
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.65
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 97.65
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.65
1wee_A72 PHD finger family protein; structural genomics, PH 97.65
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.55
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 97.54
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.51
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.47
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.47
3aad_A292 Transcription initiation factor TFIID subunit 1; p 97.43
2r0y_A311 Chromatin structure-remodeling complex protein RSC 97.41
3aad_A292 Transcription initiation factor TFIID subunit 1; p 97.4
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.31
2r10_A361 Chromatin structure-remodeling complex protein RSC 97.31
1wew_A78 DNA-binding family protein; structural genomics, P 97.25
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.23
1wem_A76 Death associated transcription factor 1; structura 97.21
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.15
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.14
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.02
2r10_A361 Chromatin structure-remodeling complex protein RSC 96.93
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 96.84
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.83
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.73
2r0y_A311 Chromatin structure-remodeling complex protein RSC 96.64
1wil_A89 KIAA1045 protein; ring finger domain, structural g 96.61
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 96.29
3kv5_D 488 JMJC domain-containing histone demethylation prote 96.24
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 95.79
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 95.33
3kv5_D 488 JMJC domain-containing histone demethylation prote 94.88
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 94.33
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 93.96
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 93.63
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 90.32
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 88.48
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 85.9
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 83.08
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 81.87
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
Probab=99.78  E-value=1.1e-19  Score=160.75  Aligned_cols=98  Identities=32%  Similarity=0.931  Sum_probs=81.5

Q ss_pred             CcccccccccccCCCCceeeccCCCCCcccccCCCCCCCCCCCccCccccccCCCCCCcccccccccCCCCccccccccC
Q 008421          295 KVHTCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTAKGFGSPHENCIVCERMNANAPRIQINQAG  374 (566)
Q Consensus       295 ~~~~C~~C~~~~~~~~ll~Cd~C~~~~H~~Cl~P~l~~~P~g~W~C~~C~~~~~~~~~~~C~~C~~l~~~~~R~~~~~~~  374 (566)
                      +++.|.+|+...+.++||+|++|++.||++|+.+++..+|.+.|+|+.|.                              
T Consensus         6 ~~~~C~~C~~~g~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~W~C~~C~------------------------------   55 (111)
T 2ysm_A            6 SGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECK------------------------------   55 (111)
T ss_dssp             CCSCBTTTCCCCCTTTSEECSSSCCEECTTTTTCCCCTTTSTTCCCTTTC------------------------------
T ss_pred             CCCCCcCCCCCCCCcCCeECCCCCCCcChHHhCCccccccccCccCCcCC------------------------------
Confidence            45689999987666677999999999999999988777777778887774                              


Q ss_pred             CCCCCCCCCCCccccccccccccCcCCCCCCCCCCccccccccccCcccccCCCcccccCCccCCCccccccCCCccccc
Q 008421          375 DEICPANGETSTEFEENSNCTTANVDKPTDNGVDSRESANLCKICGRKVEESSDKFRSCEHAFCYSKFYHERCLTPKQLK  454 (566)
Q Consensus       375 ~~~~~~~~e~~~e~E~~s~~~~~~~~~~~~e~~~s~~~~~~C~~Cgs~~~~~~~~Ll~C~~~~C~~k~yH~~CL~~~~~~  454 (566)
                                                                                                      
T Consensus        56 --------------------------------------------------------------------------------   55 (111)
T 2ysm_A           56 --------------------------------------------------------------------------------   55 (111)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCCCCccCCCcccccccccCCCCceeeccCCCCCCcCCCCCCCCCCCCCCCcccCCCcc
Q 008421          455 RYGPCWFCPSCLCRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKCDA  513 (566)
Q Consensus       455 ~~~~~w~Cp~C~C~~C~~~~~~~~ll~Cd~C~~~~H~~Cl~Ppl~~~p~~~W~C~~C~~  513 (566)
                                 .|.+|+..+++..||.||.|+++||++|+.||+..+|.+.|+|+.|..
T Consensus        56 -----------~C~~C~~~~~~~~ll~Cd~C~~~yH~~Cl~ppl~~~P~g~W~C~~C~~  103 (111)
T 2ysm_A           56 -----------VCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRI  103 (111)
T ss_dssp             -----------CCTTTCCCSCCTTEEECSSSCCEEEGGGSSSCCSSCCSSCCCCHHHHC
T ss_pred             -----------cccccCccCCCCCeeECCCCCcHHhHHhcCCccccCCCCCcCCcCCcC
Confidence                       233444444556799999999999999999999999999999999964
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 566
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 1e-12
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 4e-08
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 2e-11
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 6e-09
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 1e-10
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 1e-06
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 1e-09
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 5e-06
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 2e-08
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 6e-04
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 2e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 1e-05
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 4e-08
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 1e-04
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 2e-05
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 1e-04
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 0.001
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.4 bits (146), Expect = 1e-12
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 467 CRACLTDKDDEKIVMCDGCDQGYHLYCMDPPRTSVPKGNWFCRKC 511
           C+ C    +D+K+++CD C++ +HL+C+ P    VP G W C  C
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPAC 47
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.2
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.12
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.12
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.07
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.92
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.76
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.6
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.5
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.39
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.39
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 98.35
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.28
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 98.22
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.2
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.16
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.11
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.06
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 98.01
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.01
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.9
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.79
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.78
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 97.76
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.72
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.6
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.47
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 96.82
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 91.17
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 85.53
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 83.15
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.20  E-value=2.7e-12  Score=95.75  Aligned_cols=48  Identities=31%  Similarity=1.012  Sum_probs=45.5

Q ss_pred             cccccccccCCCCceeeccCCCCCcccccCCCCCCCCCCCccCccccc
Q 008421          298 TCRQCEEKAGEKDGLVCDSCEEMYHLSCIEPAFKDIPPKSWYCARCTA  345 (566)
Q Consensus       298 ~C~~C~~~~~~~~ll~Cd~C~~~~H~~Cl~P~l~~~P~g~W~C~~C~~  345 (566)
                      .|.+|+..++++.||+||+|+..||++|++|++..+|+++|+|+.|..
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~   49 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP   49 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcC
Confidence            599999988899999999999999999999999999999999999974
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure