Citrus Sinensis ID: 008423

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------
MAWRTCSSGWTAWWPTTRHSATSRWGAGGSTADLTLDIANRMQNTICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQIQGGFACALDLVKHIRSAYGDYFGITVAGYPEGHPDTIGPDGVASNESYQSDLLYLKKKVDAGADLIITQLFYDTDMFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEPIKDNEEAVKAYGIHLGAEMCKKILAHGIKTLHLYTLNMEKSALAILLNLGLIEESKISRSLPWRPPTNVFRVKEDVRPIFWANRPKSYLSRTVGWDQYPRGRWGDSRNPSYGALSDHQFMRPRSRDKKLHEEWAVPLKSVEDIYEKFKNYCLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYINGDLFAVFADL
cccHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHHccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHccccEEEHHHccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccEEEcccccccccccccccccccccccEEEEEcEEEEEccHHHHHHHHHHHcccccEEEEEEEcccccccccccccccEEEEcccccccccccccccccHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHccEEEEEEEccccccccHHHHHHcc
*AWRTCSSGWTAWWPTTRHSATSRWGAGGSTADLTLDIANRMQNTICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQIQGGFACALDLVKHIRSAYGDYFGITVAGYPEGHPDTIGPDGVASNESYQSDLLYLKKKVDAGADLIITQLFYDTDMFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEPIKDNEEAVKAYGIHLGAEMCKKILAHGIKTLHLYTLNMEKSALAILLNLGLIEESKISRSLPWRPP*NVFRVKEDVRPIFWANRPKSYLSRTVGWDQYPRGRWGDSRNPSYGALSDHQFMRP********EEWAVPLKSVEDIYEKFKNYCLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYINGDLFAVFADL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAWRTCSSGWTAWWPTTRHSATSRWGAGGSTADLTLDIANRMQNTICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQIQGGFACALDLVKHIRSAYGDYFGITVAGYPEGHPDTIGPDGVASNESYQSDLLYLKKKVDAGADLIITQLFYDTDMFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEPIKDNEEAVKAYGIHLGAEMCKKILAHGIKTLHLYTLNMEKSALAILLNLGLIEESKISRSLPWRPPTNVFRVKEDVRPIFWANRPKSYLSRTVGWDQYPRGRWGDSRNPSYGALSDHQFMRPRSRDKKLHEEWAVPLKSVEDIYEKFKNYCLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYINGDLFAVFADL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methylenetetrahydrofolate reductase 2 The probable reversibility of the MTHFR reaction in plants suggests that they can metabolize the methyl group of 5,10-methylenetetrahydrofolate to serine, sugars and starch.confidentO80585
Probable methylenetetrahydrofolate reductase The probable reversibility of the MTHFR reaction in plants suggests that they can metabolize the methyl group of 5,10-methylenetetrahydrofolate to serine, sugars and starch.confidentQ75HE6
Methylenetetrahydrofolate reductase 1 The probable reversibility of the MTHFR reaction in plants suggests that they can metabolize the methyl group of 5,10-methylenetetrahydrofolate to serine, sugars and starch.probableQ9SE94

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.5.-.-Acting on the CH-NH group of donors.probable
1.5.1.-5,10-methylenetetrahydromethanopterin reductase.probable
1.5.1.20Transferred entry: 1.5.1.20.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APT, chain A
Confidence level:very confident
Coverage over the Query: 10-277
View the alignment between query and template
View the model in PyMOL