Citrus Sinensis ID: 008467


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560----
MSSITSEELNYLVFRYLQESGLLHSAFVLGYEAGINKCNIDGNLVPPRALITFVQKGLQYLEMEANLTCQSDVDMDEDFSFLQPMDLITKDVCELRQMVKEKKKNLNGDRDKENDVDRGHEIEHGRVKEKERLDREKERERDKERVENEKEPEKQHESHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILASASFDSTVKLWDVELGKLLYSLNGHREPVYSLAFSPTGEYLASGSLDKSMHIWSLKEGKIVKTYTGNGGIFEVCWNKEGDKIAACFANHTVCVLDFRM
ccccccccHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccCEEEcccccccccccccEEEEEEcccccEEEECcccccEEEccccccccccccccEEEEEEcccccEEEEccccccEEEEEcccccccccccccccccEEEEccccccccccccEEEEEEcccccEEEEECccccEEEEccccccEEccccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEcccccccEEEEEEccccEEEEECccccEEEEEccccCEEEccccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEccccccccccccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEECccccEEEEEEcccccEEEEEEccccEEEEEccc
**SITSEELNYLVFRYLQESGLLHSAFVLGYEAGINKCNIDGNLVPPRALITFVQKGLQYLEMEANLTCQSDVDMDEDFSFLQPMDLITKDVCELRQMVKEKKKNLNGDRDKENDVDRGHEIEHGRVKEKERLDREKER********NEKEPEKQH*SHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILASASFDSTVKLWDVELGKLLYSLNGHREPVYSLAFSPTGEYLASGSLDKSMHIWSLKEGKIVKTYTGNGGIFEVCWNKEGDKIAACFANHTVCVLDFRM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSITSEELNYLVFRYLQESGLLHSAFVLGYEAGINKCNIDGNLVPPRALITFVQKGLQYLEMEANLTCQSDVDMDEDFSFLQPMDLITKDVCELRQMVKEKKKNLNGDRDKENDVDRGHEIEHGRVKExxxxxxxxxxxxxxxxxxxxxEPEKQHESHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILASASFDSTVKLWDVELGKLLYSLNGHREPVYSLAFSPTGEYLASGSLDKSMHIWSLKEGKIVKTYTGNGGIFEVCWNKEGDKIAACFANHTVCVLDFRM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box-like/WD repeat-containing protein TBL1Y F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange.probableQ9BQ87
F-box-like/WD repeat-containing protein TBL1XR1 F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of the N-Cor corepressor complex that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of N-Cor complex, thereby allowing cofactor exchange, and transcription activation.probableQ8BHJ5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 207-563
View the alignment between query and template
View the model in PyMOL
Template: 2XTC, chain A
Confidence level:very confident
Coverage over the Query: 3-77
View the alignment between query and template
View the model in PyMOL
Template: 1YIQ, chain A
Confidence level:confident
Coverage over the Query: 228-553
View the alignment between query and template
View the model in PyMOL