Citrus Sinensis ID: 008499


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---
MAAIPPKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSSSNWKEKSGILYTVSSWAEVHAFILGW
cccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHHcccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHccccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHccccccccEEEcccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHcccEEEEccccHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccEEEEEccHHHHHHHHHcc
ccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccEEEEEcccccEEEEccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccEEEccccHHHHHHHHHcccccccEEEEEEEccHHHHHHHHHccccccEEEcccEEEcccccccHEEEccccHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHccEEEEEcccHHHHHHHHHccccEccccHHHHHHHHHHHcccccccccccEEEEEEccHHHHHHHHHcc
maaippkspspeeeGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEecaddddaKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATAsgkvegvkgpgklatpfekTKVAAYTLGAMSPCMRLYAFLGKEFHALLnanegnhpytkwidnyssesfqaSALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFfcaqplaqptvvplikghnpagdrliifsdfdltctivdssAILAEIAIvtapksdqnqpenqlgrmssgelrntwgLLSKQYTEEYEQCIESfmpsekvenfnYETLHKALEQLSHFEKRANSRViesgvlkginlEDIKKAGerlslqdgCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHanefsfkesistgeiiekvespiDKVQAFNNTLEkygtdrknlsvYIGDSVGDLLCLLEADIGivigsssslrrvgsqfgvtfiplypglvkkqkeytegsssnwkeksGILYTVSSWAEVHAFILGW
maaippkspspeeegLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLAtasgkvegvkgpgklatpfEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVtapksdqnqpenqlgrmssgelrNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANsrviesgvlkginLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLekygtdrknlSVYIGDSVGDLLCLLEADIGIVIGsssslrrvGSQFGVTFIPLYPGLVKKQKEYtegsssnwkeksGILYTVSSWAEVHAFILGW
MAAIPPKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQayelaeecaddddaKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSSSNWKEKSGILYTVSSWAEVHAFILGW
****************ARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVT**********************NTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQK*********WKEKSGILYTVSSWAEVHAFILG*
**********PEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTA*******************LRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLE**GTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLV**************KEKSGILYTVSSWAEVHAFILGW
***************LARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQ**********WKEKSGILYTVSSWAEVHAFILGW
*****PKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPK************MSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSSSNWKEKSGILYTVSSWAEVHAFILGW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAIPPKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSSSNWKEKSGILYTVSSWAEVHAFILGW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query563 2.2.26 [Sep-21-2011]
P44659215 Uncharacterized protein H yes no 0.323 0.846 0.265 1e-13
Q8FTH8739 Thiamine biosynthesis mul yes no 0.319 0.243 0.267 5e-11
O94266551 Putative hydroxymethylpyr yes no 0.330 0.337 0.236 4e-09
Q9UUE0274 UPF0655 protein C17G9.12c no no 0.463 0.952 0.240 6e-09
Q8NQH1763 Thiamine biosynthesis mul yes no 0.365 0.269 0.262 2e-08
Q49Z42229 Putative thiaminase-2 OS= yes no 0.332 0.816 0.233 2e-05
Q2YUL0229 Putative thiaminase-2 OS= yes no 0.319 0.786 0.248 2e-05
Q6GEY1229 Putative thiaminase-2 OS= yes no 0.326 0.803 0.241 2e-05
Q7A0C8229 Putative thiaminase-2 OS= yes no 0.326 0.803 0.241 4e-05
Q6G7L6229 Putative thiaminase-2 OS= yes no 0.326 0.803 0.241 4e-05
>sp|P44659|Y358_HAEIN Uncharacterized protein HI_0358 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0358 PE=3 SV=1 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 101/211 (47%), Gaps = 29/211 (13%)

Query: 36  FTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEEL 95
           F   LA G L    F+HY+ QD+ +L  +S+A+ L    A +     +  +  + + +E+
Sbjct: 21  FVQQLAKGTLPKACFQHYLKQDYLYLFHYSRAFALGVFKAKNFAEMETPRKTLEILCQEI 80

Query: 96  KMHDSFVKEWGTDLAKMATV--NSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVA 153
           ++H ++ +EWG    ++ T   ++A + YT +LL             G LA  +      
Sbjct: 81  QLHLNYCREWGISEQEIFTTQESAACIAYTRYLLDCGMT--------GSLAELY------ 126

Query: 154 AYTLGAMSPCMRLYA----FLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDL 209
                A++PC   YA    ++ + +  L      N+PY  WID Y+SE FQ +A +  D 
Sbjct: 127 ----AAVTPCALGYAQVARYITQHYPRL-----PNNPYQTWIDTYASEEFQQAAQETVDF 177

Query: 210 LDKLSVSLTGEELDIIEKLYHQAMKLEVEFF 240
           L  L   L   +L  I++++  A ++E+ F+
Sbjct: 178 LTALCKPLNPSQLAEIQQIFTTATRMEIAFW 208





Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (taxid: 71421)
>sp|Q8FTH8|THIED_COREF Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thiED PE=3 SV=1 Back     alignment and function description
>sp|O94266|THI22_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.18c PE=3 SV=1 Back     alignment and function description
>sp|Q9UUE0|YNZC_SCHPO UPF0655 protein C17G9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17G9.12c PE=3 SV=1 Back     alignment and function description
>sp|Q8NQH1|THIED_CORGL Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=theD PE=3 SV=2 Back     alignment and function description
>sp|Q49Z42|TENA_STAS1 Putative thiaminase-2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tenA PE=3 SV=1 Back     alignment and function description
>sp|Q2YUL0|TENA_STAAB Putative thiaminase-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tenA PE=3 SV=1 Back     alignment and function description
>sp|Q6GEY1|TENA_STAAR Putative thiaminase-2 OS=Staphylococcus aureus (strain MRSA252) GN=tenA PE=1 SV=1 Back     alignment and function description
>sp|Q7A0C8|TENA_STAAW Putative thiaminase-2 OS=Staphylococcus aureus (strain MW2) GN=tenA PE=3 SV=1 Back     alignment and function description
>sp|Q6G7L6|TENA_STAAS Putative thiaminase-2 OS=Staphylococcus aureus (strain MSSA476) GN=tenA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query563
225466287566 PREDICTED: uncharacterized protein LOC10 1.0 0.994 0.793 0.0
296088278657 unnamed protein product [Vitis vinifera] 1.0 0.856 0.793 0.0
118486577618 unknown [Populus trichocarpa] 0.992 0.904 0.767 0.0
356576723607 PREDICTED: uncharacterized protein LOC10 0.976 0.906 0.780 0.0
224125750577 predicted protein [Populus trichocarpa] 0.976 0.953 0.782 0.0
356535194604 PREDICTED: uncharacterized protein LOC10 0.998 0.930 0.765 0.0
224145849541 predicted protein [Populus trichocarpa] 0.928 0.966 0.759 0.0
297805028617 hypothetical protein ARALYDRAFT_915614 [ 0.984 0.897 0.709 0.0
145358529617 heme oxygenase-like, multi-helical prote 0.978 0.893 0.712 0.0
110737432629 hypothetical protein [Arabidopsis thalia 0.978 0.875 0.712 0.0
>gi|225466287|ref|XP_002270291.1| PREDICTED: uncharacterized protein LOC100266835 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/566 (79%), Positives = 506/566 (89%), Gaps = 3/566 (0%)

Query: 1   MAAIPPKSPSP--EEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDF 58
           MAAIP  S +    EEG+ARR WIKF++ES+FAMY+PF VCLASGNLKL++FRH+IAQD 
Sbjct: 1   MAAIPKPSITTVDNEEGIARRFWIKFRKESIFAMYTPFVVCLASGNLKLDSFRHFIAQDV 60

Query: 59  HFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSA 118
           HFL+AF+QAYELAEECADDDDAKL I +LRK VLEELKMHDSFVKEWG DL+K +++NSA
Sbjct: 61  HFLRAFAQAYELAEECADDDDAKLGICQLRKSVLEELKMHDSFVKEWGFDLSKESSLNSA 120

Query: 119 TVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALL 178
           TVKY +FLLATASGK+EGVKGPGKLATPFEKTKVAAYTLGAM+PCMRLYAFLGKE  ALL
Sbjct: 121 TVKYRDFLLATASGKIEGVKGPGKLATPFEKTKVAAYTLGAMTPCMRLYAFLGKELQALL 180

Query: 179 NANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVE 238
           + +E  HPY KWIDNYSSE FQ SALQ EDLLDKLSVSLTGEELDIIEKLY+QAMKLE+E
Sbjct: 181 HPSESTHPYKKWIDNYSSEGFQGSALQTEDLLDKLSVSLTGEELDIIEKLYYQAMKLEIE 240

Query: 239 FFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQ 298
           FFCAQ L Q T+VPL KGH+PA DRL+IFSDFDLTCT+VDSSAILAEIAI+TAPK DQNQ
Sbjct: 241 FFCAQLLDQYTIVPLTKGHDPAADRLVIFSDFDLTCTVVDSSAILAEIAIITAPKFDQNQ 300

Query: 299 PENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFE 358
           PENQ+ RMSS +LRNTWG+LSKQYTEEYEQCIE+ +PSEKVE F+YE L KALEQLS FE
Sbjct: 301 PENQIIRMSSADLRNTWGVLSKQYTEEYEQCIENILPSEKVEEFDYEGLCKALEQLSDFE 360

Query: 359 KRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCG 418
           KRANSRVIESGVLKG+NL+DIK+AGERL LQDGC +FFQ +VKNE+L A+VH+LSYCWCG
Sbjct: 361 KRANSRVIESGVLKGLNLDDIKRAGERLILQDGCASFFQNIVKNESLIADVHILSYCWCG 420

Query: 419 DLIRASFSS-GLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKN 477
           DLIR++FSS GL+ LNVHANEF+FKESIS GEI++ VESPIDK++AF N LE    DRKN
Sbjct: 421 DLIRSAFSSGGLHVLNVHANEFAFKESISNGEIVKNVESPIDKLKAFLNILENCSNDRKN 480

Query: 478 LSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSS 537
           L+VYIGDSVGDLLCLL AD+GIVIGSSSSL+RVGSQFGV+F+PL+  LVKKQKEY EGSS
Sbjct: 481 LTVYIGDSVGDLLCLLNADVGIVIGSSSSLKRVGSQFGVSFVPLFRFLVKKQKEYVEGSS 540

Query: 538 SNWKEKSGILYTVSSWAEVHAFILGW 563
           S WK  SG LYTVSSWAE+HAFILGW
Sbjct: 541 SRWKGLSGTLYTVSSWAEIHAFILGW 566




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296088278|emb|CBI36504.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|118486577|gb|ABK95127.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356576723|ref|XP_003556479.1| PREDICTED: uncharacterized protein LOC100813450 [Glycine max] Back     alignment and taxonomy information
>gi|224125750|ref|XP_002319666.1| predicted protein [Populus trichocarpa] gi|222858042|gb|EEE95589.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356535194|ref|XP_003536133.1| PREDICTED: uncharacterized protein LOC100788250 [Glycine max] Back     alignment and taxonomy information
>gi|224145849|ref|XP_002325785.1| predicted protein [Populus trichocarpa] gi|222862660|gb|EEF00167.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297805028|ref|XP_002870398.1| hypothetical protein ARALYDRAFT_915614 [Arabidopsis lyrata subsp. lyrata] gi|297316234|gb|EFH46657.1| hypothetical protein ARALYDRAFT_915614 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145358529|ref|NP_198287.3| heme oxygenase-like, multi-helical protein [Arabidopsis thaliana] gi|332006501|gb|AED93884.1| heme oxygenase-like, multi-helical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110737432|dbj|BAF00660.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query563
TAIR|locus:2145816617 AT5G32470 "AT5G32470" [Arabido 0.985 0.899 0.696 2.8e-208
TIGR_CMR|BA_0725231 BA_0725 "transcriptional activ 0.332 0.809 0.229 1.1e-09
UNIPROTKB|G4MTS1304 MGG_04762 "Uncharacterized pro 0.412 0.763 0.256 9.2e-09
POMBASE|SPBC17G9.12c274 SPBC17G9.12c "hydrolase (predi 0.460 0.945 0.257 1.2e-07
UNIPROTKB|Q5HW25221 CJE0491 "TenA/Thi-4 family pro 0.339 0.864 0.231 1.5e-07
TIGR_CMR|CJE_0491221 CJE_0491 "TenA/Thi-4 family pr 0.339 0.864 0.231 1.5e-07
ASPGD|ASPL0000004890510 AN10762 [Emericella nidulans ( 0.349 0.386 0.216 7.9e-06
POMBASE|SPBP8B7.18c551 SPBP8B7.18c "TENA/THI family p 0.174 0.177 0.26 7.9e-05
SGD|S000000608317 YCR015C "Putative protein of u 0.401 0.712 0.267 0.00015
CGD|CAL0004824288 orf19.6732 [Candida albicans ( 0.323 0.631 0.252 0.00016
TAIR|locus:2145816 AT5G32470 "AT5G32470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2014 (714.0 bits), Expect = 2.8e-208, P = 2.8e-208
 Identities = 394/566 (69%), Positives = 468/566 (82%)

Query:     3 AIPPKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLK 62
             +IPP S    EE L  +LWIKF RE +F++YSPF VCLA+GNLK++TFR YIAQD HFLK
Sbjct:    57 SIPPTS----EEALPGKLWIKFNRECLFSIYSPFAVCLAAGNLKIDTFRQYIAQDVHFLK 112

Query:    63 AFSQXXXXXXXXXXXXXXKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKY 122
             AF+               KL+IS+LRK V+EELKMHDSFV++W  D+ K  +VNSAT++Y
Sbjct:   113 AFAHAYELAADCADDDDDKLAISDLRKSVMEELKMHDSFVQDWDLDINKEVSVNSATLRY 172

Query:   123 TEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANE 182
             TEFLLATASGKVEG K PG L TPFEKTKVAAYTLGA++PCMRLYAFLGKEF +LL+ ++
Sbjct:   173 TEFLLATASGKVEGCKAPGMLDTPFEKTKVAAYTLGAVTPCMRLYAFLGKEFGSLLDLSD 232

Query:   183 GNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCA 242
              NHPY KWIDNYSS++FQASA Q EDLL+KLSVS+TGEELDIIEKLY QAMKLEVEFF A
Sbjct:   233 VNHPYKKWIDNYSSDAFQASAKQTEDLLEKLSVSMTGEELDIIEKLYQQAMKLEVEFFHA 292

Query:   243 QPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQ 302
             QPLAQPT+VPL+K H+   D L+IFSDFDLTCT+VDSSAILAEIAIVTAPK +Q++   Q
Sbjct:   293 QPLAQPTIVPLLKNHSK--DDLVIFSDFDLTCTVVDSSAILAEIAIVTAPKDEQSRSGQQ 350

Query:   303 LGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRAN 362
             + RM S +L+NTW LLSKQYTE YE+CIES +  +K + F+YE L KALEQLS FEK AN
Sbjct:   351 IHRMLSSDLKNTWNLLSKQYTEHYEECIESILNKKKADKFDYEGLCKALEQLSDFEKEAN 410

Query:   363 SRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIR 422
             +RVIESGVLKG+NLEDIK+AGERL LQDGC   FQK++K ENLNA +HVLSYCWCGDLIR
Sbjct:   411 NRVIESGVLKGLNLEDIKRAGERLILQDGCINVFQKILKTENLNAELHVLSYCWCGDLIR 470

Query:   423 ASFSSG-LNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLE--KYGTDRKN-L 478
             A+FS+G ++A+ VHANEF+F+ESISTGEI  KVESPI+K Q F + L+  K   ++K+ L
Sbjct:   471 AAFSAGGVDAVEVHANEFTFEESISTGEIERKVESPINKAQQFKSILQNRKNENNKKSFL 530

Query:   479 SVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSSS 538
             SVYIGDSVGDLLCLLEADIGIV+ SSSSLRRVGS FGV+F+PL+ G+V+KQK++TE SSS
Sbjct:   531 SVYIGDSVGDLLCLLEADIGIVVSSSSSLRRVGSHFGVSFVPLFSGIVQKQKQHTEESSS 590

Query:   539 N-WKEKSGILYTVSSWAEVHAFILGW 563
             + WK  SG LYTVSSWAE+H+F LGW
Sbjct:   591 SAWKGLSGTLYTVSSWAEIHSFALGW 616




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0005829 "cytosol" evidence=IDA
TIGR_CMR|BA_0725 BA_0725 "transcriptional activator TenA, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|G4MTS1 MGG_04762 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPBC17G9.12c SPBC17G9.12c "hydrolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q5HW25 CJE0491 "TenA/Thi-4 family protein" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0491 CJE_0491 "TenA/Thi-4 family protein" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
ASPGD|ASPL0000004890 AN10762 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPBP8B7.18c SPBP8B7.18c "TENA/THI family protein" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000000608 YCR015C "Putative protein of unknown function" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0004824 orf19.6732 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.3LOW CONFIDENCE prediction!
3rd Layer1.3.3.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
COG0819218 COG0819, TenA, Putative transcription activator [T 2e-37
PTZ00347504 PTZ00347, PTZ00347, phosphomethylpyrimidine kinase 1e-24
pfam03070210 pfam03070, TENA_THI-4, TENA/THI-4/PQQC family 8e-21
PRK14713530 PRK14713, PRK14713, multifunctional hydroxymethylp 2e-20
TIGR04306208 TIGR04306, salvage_TenA, thiaminase II 1e-19
PRK09517755 PRK09517, PRK09517, multifunctional thiamine-phosp 4e-15
TIGR00338219 TIGR00338, serB, phosphoserine phosphatase SerB 3e-05
COG0560212 COG0560, SerB, Phosphoserine phosphatase [Amino ac 6e-05
>gnl|CDD|223889 COG0819, TenA, Putative transcription activator [Transcription] Back     alignment and domain information
 Score =  137 bits (347), Expect = 2e-37
 Identities = 65/210 (30%), Positives = 104/210 (49%), Gaps = 24/210 (11%)

Query: 35  PFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADD-DDAKLSISELRKGVLE 93
           PF   LA G L  E F+ Y+ QD+ +L  F++A  L    A D +  +     ++  V  
Sbjct: 22  PFVQELADGTLPREKFQFYLVQDYLYLVNFARALALLASKAPDLELMEELAKIIQFLVEG 81

Query: 94  ELKMHDSFVKEWGTDLAKMATV--NSATVKYTEFLLATA-SGKVEGVKGPGKLATPFEKT 150
           E+++H+   +E G  L ++     + A   YT +LL TA SG                  
Sbjct: 82  EMELHERLAEELGISLDELLKTEPSPANKAYTRYLLDTAYSGSF---------------- 125

Query: 151 KVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLL 210
              A  L A+ PC+  YA +GK   A   A+  N PY +WID Y+SE FQ +  + E LL
Sbjct: 126 ---AELLAALLPCLWGYAEIGKRLKAKPRASP-NPPYQEWIDTYASEEFQEAVEELEALL 181

Query: 211 DKLSVSLTGEELDIIEKLYHQAMKLEVEFF 240
           D L+ + + EEL+ +++++  A + E+ F+
Sbjct: 182 DSLAENSSEEELEKLKQIFLTASRFELAFW 211


Length = 218

>gnl|CDD|240375 PTZ00347, PTZ00347, phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|217351 pfam03070, TENA_THI-4, TENA/THI-4/PQQC family Back     alignment and domain information
>gnl|CDD|237797 PRK14713, PRK14713, multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|213919 TIGR04306, salvage_TenA, thiaminase II Back     alignment and domain information
>gnl|CDD|169939 PRK09517, PRK09517, multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|232927 TIGR00338, serB, phosphoserine phosphatase SerB Back     alignment and domain information
>gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 563
COG0819218 TenA Putative transcription activator [Transcripti 100.0
PRK14713530 multifunctional hydroxymethylpyrimidine phosphokin 100.0
PTZ00347504 phosphomethylpyrimidine kinase; Provisional 100.0
PRK09517755 multifunctional thiamine-phosphate pyrophosphoryla 100.0
PF03070210 TENA_THI-4: TENA/THI-4/PQQC family; InterPro: IPR0 100.0
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 99.95
KOG2598523 consensus Phosphomethylpyrimidine kinase [Coenzyme 99.91
COG4359220 Uncharacterized conserved protein [Function unknow 99.91
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.91
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.89
PRK11133322 serB phosphoserine phosphatase; Provisional 99.87
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.87
KOG3128298 consensus Uncharacterized conserved protein [Funct 99.85
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 99.85
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 99.83
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.82
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 99.82
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.8
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.8
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.78
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.78
PRK11590211 hypothetical protein; Provisional 99.73
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.73
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.73
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 99.7
PLN02954224 phosphoserine phosphatase 99.68
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.53
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 99.53
PLN02177 497 glycerol-3-phosphate acyltransferase 99.36
PRK08238 479 hypothetical protein; Validated 99.13
PRK13222226 phosphoglycolate phosphatase; Provisional 98.96
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 98.9
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 98.9
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.9
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 98.89
PRK13288214 pyrophosphatase PpaX; Provisional 98.86
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 98.84
PRK13226229 phosphoglycolate phosphatase; Provisional 98.82
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 98.82
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 98.8
PRK13223272 phosphoglycolate phosphatase; Provisional 98.72
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 98.72
PRK11587218 putative phosphatase; Provisional 98.69
PRK05157246 pyrroloquinoline quinone biosynthesis protein PqqC 98.69
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 98.69
PRK13225273 phosphoglycolate phosphatase; Provisional 98.69
PLN02575381 haloacid dehalogenase-like hydrolase 98.69
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 98.68
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 98.67
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 98.64
COG5424242 Pyrroloquinoline quinone (Coenzyme PQQ) biosynthes 98.64
PRK14988224 GMP/IMP nucleotidase; Provisional 98.62
PLN02770248 haloacid dehalogenase-like hydrolase family protei 98.61
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 98.59
TIGR02111239 PQQ_syn_pqqC coenzyme PQQ biosynthesis protein C. 98.59
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 98.56
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 98.56
PRK09449224 dUMP phosphatase; Provisional 98.56
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 98.53
COG0546220 Gph Predicted phosphatases [General function predi 98.52
PLN02940 382 riboflavin kinase 98.5
PLN02779286 haloacid dehalogenase-like hydrolase family protei 98.45
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 98.4
PRK10563221 6-phosphogluconate phosphatase; Provisional 98.36
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 98.32
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 98.32
PHA02597197 30.2 hypothetical protein; Provisional 98.31
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 98.27
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 98.25
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 98.24
PLN02499 498 glycerol-3-phosphate acyltransferase 98.24
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.23
PRK01122679 potassium-transporting ATPase subunit B; Provision 98.2
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 98.19
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 98.19
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 98.16
PRK14010673 potassium-transporting ATPase subunit B; Provision 98.14
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 98.09
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.08
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 98.07
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 98.03
PRK10748238 flavin mononucleotide phosphatase; Provisional 98.03
COG4030315 Uncharacterized protein conserved in archaea [Func 97.97
PLN02811220 hydrolase 97.97
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 97.97
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 97.96
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.94
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 97.93
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 97.93
PRK15122 903 magnesium-transporting ATPase; Provisional 97.91
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 97.91
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 97.88
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 97.82
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 97.82
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 97.8
COG0637221 Predicted phosphatase/phosphohexomutase [General f 97.8
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 97.79
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 97.78
PRK10671834 copA copper exporting ATPase; Provisional 97.76
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.72
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.67
PRK10513270 sugar phosphate phosphatase; Provisional 97.66
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 97.65
PRK10976266 putative hydrolase; Provisional 97.62
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 97.61
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 97.6
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 97.59
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 97.58
COG4087152 Soluble P-type ATPase [General function prediction 97.55
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 97.52
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 97.5
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 97.47
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 97.46
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 97.44
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 97.43
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 97.39
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 97.37
PRK01158230 phosphoglycolate phosphatase; Provisional 97.34
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 97.33
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 97.3
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 97.29
PLN02887580 hydrolase family protein 97.28
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 97.28
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 97.24
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.24
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.23
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 97.21
CHL00168238 pbsA heme oxygenase; Provisional 97.19
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 97.17
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 97.15
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 97.14
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 97.13
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 97.07
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 97.06
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 97.04
cd00232203 HemeO Heme oxygenase catalyzes the rate limiting s 96.96
PRK06769173 hypothetical protein; Validated 96.96
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 96.95
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 96.93
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 96.88
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 96.86
PLN02382 413 probable sucrose-phosphatase 96.84
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 96.78
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 96.74
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 96.68
PLN03190 1178 aminophospholipid translocase; Provisional 96.68
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 96.68
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 96.62
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 96.6
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 96.58
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 96.55
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 96.51
PHA02530300 pseT polynucleotide kinase; Provisional 96.41
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 96.39
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 96.09
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 96.02
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 95.99
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 95.92
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 95.8
KOG0204 1034 consensus Calcium transporting ATPase [Inorganic i 95.44
PTZ00174247 phosphomannomutase; Provisional 95.34
COG0241181 HisB Histidinol phosphatase and related phosphatas 95.26
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 95.09
KOG0210 1051 consensus P-type ATPase [Inorganic ion transport a 95.01
PF12981231 DUF3865: Domain of Unknown Function with PDB struc 94.87
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 94.74
PF01126205 Heme_oxygenase: Heme oxygenase; InterPro: IPR01605 94.59
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 94.3
PLN02423245 phosphomannomutase 94.24
COG2503274 Predicted secreted acid phosphatase [General funct 94.14
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 94.08
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 93.38
TIGR01675229 plant-AP plant acid phosphatase. This model explic 93.36
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 93.14
PLN02580384 trehalose-phosphatase 92.85
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 92.65
COG5398238 Heme oxygenase [Inorganic ion transport and metabo 92.44
KOG0206 1151 consensus P-type ATPase [General function predicti 91.78
COG3700237 AphA Acid phosphatase (class B) [General function 91.11
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 90.93
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 90.91
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 89.47
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 89.2
KOG0203 1019 consensus Na+/K+ ATPase, alpha subunit [Inorganic 86.2
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 85.7
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 85.23
TIGR01684301 viral_ppase viral phosphatase. These proteins also 85.2
KOG0208 1140 consensus Cation transport ATPase [Inorganic ion t 84.7
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 84.45
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 84.33
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 84.24
KOG0209 1160 consensus P-type ATPase [Inorganic ion transport a 83.74
PHA03398303 viral phosphatase superfamily protein; Provisional 83.41
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 82.22
>COG0819 TenA Putative transcription activator [Transcription] Back     alignment and domain information
Probab=100.00  E-value=1e-46  Score=364.87  Aligned_cols=210  Identities=30%  Similarity=0.472  Sum_probs=195.4

Q ss_pred             chHHHHHHHHhHHhHHHhhcCHHHHHhhcCCCCHHHHHHHHHhhHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHH-
Q 008499           14 EGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVL-   92 (563)
Q Consensus        14 ~~~~~~lw~~~~~~~~~~~~hPFv~~la~GtL~~~~f~~Yl~QD~~yl~~f~r~~~~~~~~a~~~~~~~~l~~~~~~i~-   92 (563)
                      +.|++.||+..++.|...++||||++|++||||.++|++||+|||+||.+|+|+++++++|+++.+.+..+...+..+. 
T Consensus         1 ~~f~~~L~~~~~~~W~~~~~H~FV~~L~~GtL~~~~F~~YL~QDy~YL~~~~ra~~~~~~ka~~~~~~~~~~~~~~~~~~   80 (218)
T COG0819           1 MMFSEELIRAAQPIWQKYIEHPFVQELADGTLPREKFQFYLVQDYLYLVNFARALALLASKAPDLELMEELAKIIQFLVE   80 (218)
T ss_pred             CchHHHHHHHhHHHHHHHcCCHHHHHHHcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHH
Confidence            4689999999999999999999999999999999999999999999999999999999999999999888887777665 


Q ss_pred             HHHHHHHHHHHHhCCCccc--ccCCChhHHHHHHHHHHHhc-CCCCCCCCCCCCCCchhhhhhhHHHHHHHHHHHHHHHH
Q 008499           93 EELKMHDSFVKEWGTDLAK--MATVNSATVKYTEFLLATAS-GKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAF  169 (563)
Q Consensus        93 ~E~~~h~~~~~~~gi~~~~--~~~~~p~~~~Y~~fl~~~a~-~~~~~~~~~~~~~~~~~~~~~~a~~l~Al~pC~~~Y~~  169 (563)
                      .|+.+|+++++++||+.++  ..+++|+|.+|++||++++. |+                   ++++++||+||+|+|++
T Consensus        81 ~E~~~h~~~~~~lgis~~~~~~~~~~~~~~aYt~ym~~~~~~g~-------------------~~~~~aAl~PC~~~Y~e  141 (218)
T COG0819          81 GEMELHERLAEELGISLDELLKTEPSPANKAYTRYLLDTAYSGS-------------------FAELLAALLPCLWGYAE  141 (218)
T ss_pred             HHHHHHHHHHHHhCCCHHHHHhcCCCchHHHHHHHHHHHHhcCC-------------------HHHHHHHHHHHHHHHHH
Confidence            5999999999999999742  57899999999999999996 54                   36899999999999999


Q ss_pred             HHHHHHhhccCCCCcccccccccccCChhHHHHHHHHHHHHHHhhccCCHHHHHHHHHHHHHHHHHHHHhhccC
Q 008499          170 LGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQ  243 (563)
Q Consensus       170 ig~~~~~~~~~~~~~~~y~~Wi~~y~s~~f~~~v~~l~~~ld~~~~~~~~~~~~~~~~~f~~~~~lE~~Fw~~a  243 (563)
                      ||+++..... ..++++|++||++|+|++|.+.|.+++++||+++...+++++++|.++|.+++++|.+||++|
T Consensus       142 ig~~~~~~~~-~~~~~~Y~~Wi~~Y~s~ef~~~v~~~~~~ld~~~~~~~~~~~~~l~~iF~~ss~~E~~Fwd~a  214 (218)
T COG0819         142 IGKRLKAKPR-ASPNPPYQEWIDTYASEEFQEAVEELEALLDSLAENSSEEELEKLKQIFLTASRFELAFWDMA  214 (218)
T ss_pred             HHHHHHhccc-cCCCCcHHHHHHHcCCHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999988653 347899999999999999999999999999999999999999999999999999999999999



>PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional Back     alignment and domain information
>PTZ00347 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PF03070 TENA_THI-4: TENA/THI-4/PQQC family; InterPro: IPR004305 Proteins containing this domain are found in all the three major phyla of life: archaebacteria, eubacteria, and eukaryotes Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>KOG2598 consensus Phosphomethylpyrimidine kinase [Coenzyme transport and metabolism; Transcription] Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK05157 pyrroloquinoline quinone biosynthesis protein PqqC; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>COG5424 Pyrroloquinoline quinone (Coenzyme PQQ) biosynthesis protein C [Coenzyme metabolism] Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR02111 PQQ_syn_pqqC coenzyme PQQ biosynthesis protein C Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>CHL00168 pbsA heme oxygenase; Provisional Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>cd00232 HemeO Heme oxygenase catalyzes the rate limiting step in the degradation of heme to bilirubin, it is essential for recycling of iron from heme Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12981 DUF3865: Domain of Unknown Function with PDB structure (DUF3865); InterPro: IPR024477 This entry represents a family of proteins of unknown function Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PF01126 Heme_oxygenase: Heme oxygenase; InterPro: IPR016053 Haem oxygenase (1 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>COG5398 Heme oxygenase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
2rd3_A223 Crystal Structure Of Tena Homologue (Hp1287) From H 4e-09
3ibx_A221 Crystal Structure Of F47y Variant Of Tena (Hp1287) 1e-08
2gm7_A221 Tena HomologTHI-4 Thiaminase From Pyrobaculum Aerop 2e-06
3mvu_A226 Crystal Structure Of A Tena Family Transcription Re 7e-06
1yaf_A263 Structure Of Tena From Bacillus Subtilis Length = 2 6e-05
2qcx_A263 Crystal Structure Of Bacillus Subtilis Tena Y112f M 9e-05
1tyh_A248 Crystal Structure Of Transcriptional Activator Tena 2e-04
1to9_A260 Crystal Structure Of Thi-4 Protein From Bacillus Su 3e-04
1to9_B260 Crystal Structure Of Thi-4 Protein From Bacillus Su 3e-04
>pdb|2RD3|A Chain A, Crystal Structure Of Tena Homologue (Hp1287) From Helicobacter Pylori Length = 223 Back     alignment and structure

Iteration: 1

Score = 60.1 bits (144), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 54/209 (25%), Positives = 95/209 (45%), Gaps = 22/209 (10%) Query: 35 PFTVCLASGNLKLETFRHYIAQDFHFLKAFSQXXXXXXXXXXXXXXKLSISELRKGVLE- 93 PF + G L+ + FR YI QD+ FL +++ S + +L Sbjct: 28 PFVQGIGRGTLERDKFRFYIIQDYLFLLEYAKVFALGVVKACDEAVMREFSNAIQDILNN 87 Query: 94 ELKMHDSFVKEWGTDLAKM--ATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTK 151 E+ +H+ +++E ++ A A YT ++LA EG KG K + Sbjct: 88 EMSIHNHYIRELQITQKELQNACPTLANKSYTSYMLA------EGFKGSIK--------E 133 Query: 152 VAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLD 211 VAA A+ C Y + + + NA E + Y WI YSS+ FQA N +LLD Sbjct: 134 VAA----AVLSCGWSYLVIAQNLSQIPNALE-HAFYGHWIKGYSSKEFQACVNWNINLLD 188 Query: 212 KLSVSLTGEELDIIEKLYHQAMKLEVEFF 240 L+++ + +E++ +++++ + E F+ Sbjct: 189 SLTLASSKQEIEKLKEIFITTSEYEYLFW 217
>pdb|3IBX|A Chain A, Crystal Structure Of F47y Variant Of Tena (Hp1287) From Helicobacter Pylori Length = 221 Back     alignment and structure
>pdb|2GM7|A Chain A, Tena HomologTHI-4 Thiaminase From Pyrobaculum Aerophilum Length = 221 Back     alignment and structure
>pdb|3MVU|A Chain A, Crystal Structure Of A Tena Family Transcription Regulator (Tm1040_3656) From Silicibacter Sp. Tm1040 At 1.80 A Resolu Length = 226 Back     alignment and structure
>pdb|1YAF|A Chain A, Structure Of Tena From Bacillus Subtilis Length = 263 Back     alignment and structure
>pdb|2QCX|A Chain A, Crystal Structure Of Bacillus Subtilis Tena Y112f Mutant Complexed With Formyl Aminomethyl Pyrimidine Length = 263 Back     alignment and structure
>pdb|1TYH|A Chain A, Crystal Structure Of Transcriptional Activator Tena From Bacillus Subtilis Length = 248 Back     alignment and structure
>pdb|1TO9|A Chain A, Crystal Structure Of Thi-4 Protein From Bacillus Subtilis Length = 260 Back     alignment and structure
>pdb|1TO9|B Chain B, Crystal Structure Of Thi-4 Protein From Bacillus Subtilis Length = 260 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
2a2m_A258 Hypothetical protein BT3146; putative TENA family 6e-42
3ibx_A221 TENA, HP1287, putative thiaminase II; vitamin B1, 3e-39
2qcx_A263 Transcriptional activator TENA; UP-DOWN bundle, hy 2e-38
1rtw_A220 Transcriptional activator, putative; PF1337, TENA, 3e-37
2f2g_A221 SEED maturation protein PM36 homolog; TENA_THI-4 d 7e-37
2gm8_A221 TENA homolog/THI-4 thiaminase; transcription, tran 2e-36
3no6_A248 Transcriptional activator TENA; structural genomic 4e-36
1udd_A226 Transcriptional regulator; helix-bundle, lipid bin 4e-36
2qzc_A214 Transcriptional activator TENA-1; heme oxygenase-l 5e-36
3mvu_A226 TENA family transcriptional regulator; TENA/THI-4/ 5e-35
1z72_A225 Transcriptional regulator, putative; structu genom 6e-32
3rm5_A550 Hydroxymethylpyrimidine/phosphomethylpyrimidine K 9e-30
1wwm_A190 Hypothetical protein TT2028; TENA/THI-4 family, pu 6e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 7e-08
1rcw_A231 CT610, CADD; iron, DI-iron, redox enzyme, metallo 1e-07
3oql_A262 TENA homolog; transcriptional activator, structura 5e-07
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 3e-06
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 6e-06
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 1e-05
2g09_A297 Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMP 1e-05
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 4e-05
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 5e-05
>2a2m_A Hypothetical protein BT3146; putative TENA family transcriptional regulator, structural G joint center for structural genomics; 1.88A {Bacteroides thetaiotaomicron} SCOP: a.132.1.3 PDB: 2a2o_A Length = 258 Back     alignment and structure
 Score =  150 bits (380), Expect = 6e-42
 Identities = 39/239 (16%), Positives = 82/239 (34%), Gaps = 29/239 (12%)

Query: 4   IPPKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKA 63
              KS  P  + L  +LW      +V  + + +   +A+G L    +   + QD ++   
Sbjct: 38  TTLKSDVPAADSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLMVQDGYYCFR 97

Query: 64  FSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYT 123
               Y  A  CA D+  +       K   E    ++++ + W    A      +    Y 
Sbjct: 98  GRDDYATAATCAQDETLREFFKAKAKSYDE---YNETYHQTWHLREASGLIPGTDIKDYA 154

Query: 124 EFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEG 183
           ++    A                   +  + Y    M PC  L+ ++      L      
Sbjct: 155 DYEAYVA------------------GSLASPYMCVVMLPCEYLWPWIANF---LDGYTPT 193

Query: 184 NHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCA 242
           N  Y  WI+        A  +   ++L++    +  ++     ++++ AM  E++ F +
Sbjct: 194 NSLYRFWIEWNGGTPNGAYQM--GNMLEQYRDKIDEDKA---VEIFNTAMNYELKVFTS 247


>3ibx_A TENA, HP1287, putative thiaminase II; vitamin B1, hydrol; 2.40A {Helicobacter pylori} PDB: 2rd3_A Length = 221 Back     alignment and structure
>2qcx_A Transcriptional activator TENA; UP-DOWN bundle, hydrolase; HET: PF1; 2.20A {Bacillus subtilis} PDB: 1yak_A* 1yaf_A* 1to9_A* 1tyh_A Length = 263 Back     alignment and structure
>1rtw_A Transcriptional activator, putative; PF1337, TENA, thiamin, structural genomics, PSI, protein STR initiative; HET: MP5; 2.35A {Pyrococcus furiosus} SCOP: a.132.1.3 Length = 220 Back     alignment and structure
>2f2g_A SEED maturation protein PM36 homolog; TENA_THI-4 domain, TENA/THI-4/PQQC family, AT3G16990, struct genomics, protein structure initiative; HET: HMH; 2.10A {Arabidopsis thaliana} SCOP: a.132.1.3 PDB: 2q4x_A* Length = 221 Back     alignment and structure
>2gm8_A TENA homolog/THI-4 thiaminase; transcription, transferase; HET: HMH; 2.50A {Pyrobaculum aerophilum} SCOP: a.132.1.3 PDB: 2gm7_A* Length = 221 Back     alignment and structure
>3no6_A Transcriptional activator TENA; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.65A {Staphylococcus epidermidis} Length = 248 Back     alignment and structure
>1udd_A Transcriptional regulator; helix-bundle, lipid binding protein; 2.15A {Pyrococcus horikoshii} SCOP: a.132.1.3 Length = 226 Back     alignment and structure
>2qzc_A Transcriptional activator TENA-1; heme oxygenase-like fold, structural genomics, joint center structural genomics, JCSG; 1.50A {Sulfolobus solfataricus P2} Length = 214 Back     alignment and structure
>3mvu_A TENA family transcriptional regulator; TENA/THI-4/PQQC family, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Length = 226 Back     alignment and structure
>1z72_A Transcriptional regulator, putative; structu genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 1.45A {Streptococcus pneumoniae} SCOP: a.132.1.3 PDB: 2a6b_A Length = 225 Back     alignment and structure
>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Length = 550 Back     alignment and structure
>1wwm_A Hypothetical protein TT2028; TENA/THI-4 family, putative transctiption activator, structu genomics; 2.61A {Thermus thermophilus} SCOP: a.132.1.3 Length = 190 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 Back     alignment and structure
>1rcw_A CT610, CADD; iron, DI-iron, redox enzyme, metallo enzyme, oxidoreductase,; 2.50A {Chlamydia trachomatis} SCOP: a.132.1.4 Length = 231 Back     alignment and structure
>3oql_A TENA homolog; transcriptional activator, structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.54A {Pseudomonas syringae PV} Length = 262 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Length = 415 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211 Back     alignment and structure
>2g09_A Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMPH-1, pyrim nucleotidase 1, P5N-1, NT5C3 protein, AAH38029, BC038029, M LEAD poisoning; HET: PIN; 2.10A {Mus musculus} PDB: 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Length = 297 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query563
3no6_A248 Transcriptional activator TENA; structural genomic 100.0
3mvu_A226 TENA family transcriptional regulator; TENA/THI-4/ 100.0
3ibx_A221 TENA, HP1287, putative thiaminase II; vitamin B1, 100.0
4fn6_A229 Thiaminase-2, thiaminase II; alpha-helix, vitamin 100.0
2qcx_A263 Transcriptional activator TENA; UP-DOWN bundle, hy 100.0
1z72_A225 Transcriptional regulator, putative; structu genom 100.0
1rtw_A220 Transcriptional activator, putative; PF1337, TENA, 100.0
2f2g_A221 SEED maturation protein PM36 homolog; TENA_THI-4 d 100.0
2gm8_A221 TENA homolog/THI-4 thiaminase; transcription, tran 100.0
1udd_A226 Transcriptional regulator; helix-bundle, lipid bin 100.0
2qzc_A214 Transcriptional activator TENA-1; heme oxygenase-l 100.0
3rm5_A550 Hydroxymethylpyrimidine/phosphomethylpyrimidine K 100.0
2a2m_A258 Hypothetical protein BT3146; putative TENA family 100.0
1wwm_A190 Hypothetical protein TT2028; TENA/THI-4 family, pu 100.0
3oql_A262 TENA homolog; transcriptional activator, structura 100.0
1rcw_A231 CT610, CADD; iron, DI-iron, redox enzyme, metallo 99.96
3dde_A239 TENA/THI-4 protein, domain of unknown function WI 99.92
3hlx_A258 Pyrroloquinoline-quinone synthase; PQQC, PQQ biosy 99.91
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 99.86
3fvv_A232 Uncharacterized protein; unknown function, structu 99.84
3bjd_A332 Putative 3-oxoacyl-(acyl-carrier-protein) synthas; 99.81
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.73
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.72
4gxt_A385 A conserved functionally unknown protein; structur 99.71
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.69
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.62
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.56
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.53
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.53
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.38
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 99.36
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.27
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.2
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.11
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.1
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.08
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.07
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.05
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.03
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.02
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.0
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.98
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.98
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.98
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 98.97
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.97
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.97
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.94
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.94
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.92
1te2_A226 Putative phosphatase; structural genomics, phospha 98.9
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 98.88
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.88
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.88
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.87
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 98.86
2hsz_A243 Novel predicted phosphatase; structural genomics, 98.86
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 98.86
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.85
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.85
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 98.84
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 98.82
1y8a_A332 Hypothetical protein AF1437; structural genomics, 98.81
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 98.81
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 98.79
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.79
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 98.79
3b5o_A244 CADD-like protein of unknown function; structural 98.78
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 98.78
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 98.77
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 98.76
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.75
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 98.72
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 98.72
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 98.7
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 98.7
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 98.69
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.68
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.68
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.66
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 98.66
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 98.65
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.65
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 98.63
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 98.63
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 98.62
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 98.6
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.58
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.57
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 98.49
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 97.87
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 98.46
3mmz_A176 Putative HAD family hydrolase; structural genomics 98.36
2p11_A231 Hypothetical protein; putative haloacid dehalogena 98.35
2zg6_A220 Putative uncharacterized protein ST2620, probable 98.35
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 98.34
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 98.31
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.29
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.28
1l6r_A227 Hypothetical protein TA0175; structural genomics, 98.27
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 98.23
3mn1_A189 Probable YRBI family phosphatase; structural genom 98.19
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 98.15
2o2x_A218 Hypothetical protein; structural genomics, joint c 98.13
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 98.12
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.12
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 98.11
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.11
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.09
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.06
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 98.05
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.04
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.03
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 98.02
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 97.99
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 97.98
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 97.98
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 97.97
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 97.97
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 97.96
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 97.94
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 97.91
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.9
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 97.89
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.87
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 97.86
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.86
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 97.74
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 97.74
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 97.71
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 97.69
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 97.69
2q32_A264 Heme oxygenase 2, HO-2; structural genomics medica 97.61
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 97.54
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 97.53
1wov_A250 Heme oxygenase 2; HOMO dimer, oxidoreductase; HET: 97.52
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 97.52
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 97.51
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 97.5
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 97.49
3dao_A283 Putative phosphatse; structural genomics, joint ce 97.48
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 97.47
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 97.46
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 97.43
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 97.39
1j02_A267 Heme oxygenase 1; alpha helix, O2-analog bound for 97.26
1we1_A240 Heme oxygenase 1; oxidoreductase; HET: HEM; 2.50A 97.23
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 97.16
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 97.1
1n45_A233 Heme oxygenase 1, HO-1; alpha helices, heme-bindin 97.1
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 97.09
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 97.06
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 96.99
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 96.99
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 96.98
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 96.98
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 96.98
1wzd_A215 Heme oxygenase; electron-transfer, artificial meta 96.94
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 96.93
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 96.82
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 96.76
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 96.71
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 96.69
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 96.56
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.25
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.99
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 95.9
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 95.87
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 94.55
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 94.31
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 94.31
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 93.71
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 93.32
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 92.34
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 92.31
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 87.77
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 87.29
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 87.11
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 86.49
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 83.92
1sk7_A198 Hypothetical protein PA-HO; heme oxygenase, heme d 80.79
>3no6_A Transcriptional activator TENA; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.65A {Staphylococcus epidermidis} SCOP: a.132.1.0 Back     alignment and structure
Probab=100.00  E-value=4.4e-48  Score=385.26  Aligned_cols=222  Identities=19%  Similarity=0.233  Sum_probs=202.3

Q ss_pred             CcchHHHHHHHHhHHhHHHhhcCHHHHHhhcCCCCHHHHHHHHHhhHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHH
Q 008499           12 EEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGV   91 (563)
Q Consensus        12 ~~~~~~~~lw~~~~~~~~~~~~hPFv~~la~GtL~~~~f~~Yl~QD~~yl~~f~r~~~~~~~~a~~~~~~~~l~~~~~~i   91 (563)
                      ..++|+++||++..+.|..+++||||++|++||||.++|++||+||++||.+|+|+++++++|+++.+++..+...+..+
T Consensus        18 ~~~~ft~~L~~~~~~~w~~~~~HPFv~~L~~GtL~~e~F~~YL~QD~~YL~~far~~a~a~aka~~~~~~~~~~~~~~~~   97 (248)
T 3no6_A           18 QGMTFSKELREASRPIIDDIYNDGFIQDLLAGKLSNQAVRQYLRADASYLKEFTNIYAMLIPKMSSMEDVKFLVEQIEFM   97 (248)
T ss_dssp             TTBCHHHHHHHHHHHHHHHHHHSHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHGGGCSCHHHHHHHHHHHHHH
T ss_pred             CCccHHHHHHHhCHHHHHHHHCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHH
Confidence            45789999999999999999999999999999999999999999999999999999999999999999999999998887


Q ss_pred             H-HHHHHHHHHHHHhCCCcc---cccCCChhHHHHHHHHHHHhcC-CCCCCCCCCCCCCchhhhhhhHHHHHHHHHHHHH
Q 008499           92 L-EELKMHDSFVKEWGTDLA---KMATVNSATVKYTEFLLATASG-KVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRL  166 (563)
Q Consensus        92 ~-~E~~~h~~~~~~~gi~~~---~~~~~~p~~~~Y~~fl~~~a~~-~~~~~~~~~~~~~~~~~~~~~a~~l~Al~pC~~~  166 (563)
                      . +|+++|++++++||++.+   +..+++|+|++|++||++++.. +.                  ++++++||+||+|+
T Consensus        98 ~~~E~~lh~~~~~~~gi~~~~~~~~~~~~p~~~aYt~~ll~~a~~~g~------------------~~~~laAl~PC~w~  159 (248)
T 3no6_A           98 LEGEVEAHEVLADFINEPYEEIVKEKVWPPSGDHYIKHMYFNAFAREN------------------AAFTIAAMAPCPYV  159 (248)
T ss_dssp             HTCCCHHHHHHHHHTTSCHHHHCCSCCCCHHHHHHHHHHHHHHHHCSS------------------THHHHHHHTHHHHH
T ss_pred             HHHHHHHHHHHHHHcCCCHHHHhhhcCCCHHHHHHHHHHHHHHhcCCC------------------HHHHHHHHHHHHHH
Confidence            5 699999999999999976   3468899999999999999953 32                  37899999999999


Q ss_pred             HHHHHHHHHhhccCCCCcccccccccccCChhHHHHHHHHHHHHHHhhccCCHHHHHHHHHHHHHHHHHHHHhhccCCCC
Q 008499          167 YAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLA  246 (563)
Q Consensus       167 Y~~ig~~~~~~~~~~~~~~~y~~Wi~~y~s~~f~~~v~~l~~~ld~~~~~~~~~~~~~~~~~f~~~~~lE~~Fw~~a~~~  246 (563)
                      |++||+++.....+ .++++|++||++|+ ++|.+.|.+++++||+++..++++++++|+++|+++|++|++|||++ ++
T Consensus       160 Y~eig~~l~~~~~~-~~~~~Y~~WI~~Y~-~ef~~~v~~~~~~ld~~~~~~s~~~~~~l~~~F~~a~~lE~~Fwd~a-y~  236 (248)
T 3no6_A          160 YAVIGKRAMEDPKL-NKESVTSKWFQFYS-TEMDELVDVFDQLMDRLTKHCSETEKKEIKENFLQSTIHERHFFNMA-YI  236 (248)
T ss_dssp             HHHHHHHHHHCTTC-CTTSTTHHHHHHHH-HHTHHHHHHHHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHHHHHHHH-HH
T ss_pred             HHHHHHHHHhcCCC-CCCchHHHHHHHHH-HHHHHHHHHHHHHHHHHhhhCCHHHHHHHHHHHHHHHHHHHHHHHHH-hh
Confidence            99999999875432 25799999999999 99999999999999999999999999999999999999999999999 77


Q ss_pred             CCccccccc
Q 008499          247 QPTVVPLIK  255 (563)
Q Consensus       247 ~~~~~p~~~  255 (563)
                      +.+ ||+..
T Consensus       237 ~e~-W~~~~  244 (248)
T 3no6_A          237 NEK-WEYGG  244 (248)
T ss_dssp             TCC-CCCSS
T ss_pred             hcc-CCCCC
Confidence            665 56533



>3mvu_A TENA family transcriptional regulator; TENA/THI-4/PQQC family, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} SCOP: a.132.1.0 Back     alignment and structure
>3ibx_A TENA, HP1287, putative thiaminase II; vitamin B1, hydrol; 2.40A {Helicobacter pylori} PDB: 2rd3_A Back     alignment and structure
>4fn6_A Thiaminase-2, thiaminase II; alpha-helix, vitamin B1, BI-functional enzyme, C of thiamine INTO HMP and THZ; HET: CME; 2.69A {Staphylococcus aureus} Back     alignment and structure
>2qcx_A Transcriptional activator TENA; UP-DOWN bundle, hydrolase; HET: PF1; 2.20A {Bacillus subtilis} PDB: 1yak_A* 1yaf_A* 1to9_A* 1tyh_A Back     alignment and structure
>1z72_A Transcriptional regulator, putative; structu genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 1.45A {Streptococcus pneumoniae} SCOP: a.132.1.3 PDB: 2a6b_A Back     alignment and structure
>1rtw_A Transcriptional activator, putative; PF1337, TENA, thiamin, structural genomics, PSI, protein STR initiative; HET: MP5; 2.35A {Pyrococcus furiosus} SCOP: a.132.1.3 Back     alignment and structure
>2f2g_A SEED maturation protein PM36 homolog; TENA_THI-4 domain, TENA/THI-4/PQQC family, AT3G16990, struct genomics, protein structure initiative; HET: HMH; 2.10A {Arabidopsis thaliana} SCOP: a.132.1.3 PDB: 2q4x_A* Back     alignment and structure
>2gm8_A TENA homolog/THI-4 thiaminase; transcription, transferase; HET: HMH; 2.50A {Pyrobaculum aerophilum} SCOP: a.132.1.3 PDB: 2gm7_A* Back     alignment and structure
>1udd_A Transcriptional regulator; helix-bundle, lipid binding protein; 2.15A {Pyrococcus horikoshii} SCOP: a.132.1.3 Back     alignment and structure
>2qzc_A Transcriptional activator TENA-1; heme oxygenase-like fold, structural genomics, joint center structural genomics, JCSG; 1.50A {Sulfolobus solfataricus P2} Back     alignment and structure
>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Back     alignment and structure
>2a2m_A Hypothetical protein BT3146; putative TENA family transcriptional regulator, structural G joint center for structural genomics; 1.88A {Bacteroides thetaiotaomicron} SCOP: a.132.1.3 PDB: 2a2o_A Back     alignment and structure
>1wwm_A Hypothetical protein TT2028; TENA/THI-4 family, putative transctiption activator, structu genomics; 2.61A {Thermus thermophilus} SCOP: a.132.1.3 Back     alignment and structure
>3oql_A TENA homolog; transcriptional activator, structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.54A {Pseudomonas syringae PV} Back     alignment and structure
>1rcw_A CT610, CADD; iron, DI-iron, redox enzyme, metallo enzyme, oxidoreductase,; 2.50A {Chlamydia trachomatis} SCOP: a.132.1.4 Back     alignment and structure
>3dde_A TENA/THI-4 protein, domain of unknown function WI oxygenase-like fold; structural genomics, joint center for structural genomics; HET: MSE PGE; 2.30A {Shewanella denitrificans OS217} Back     alignment and structure
>3hlx_A Pyrroloquinoline-quinone synthase; PQQC, PQQ biosynthesis, oxidase, complex, all helical, oxido; HET: PQQ; 1.30A {Klebsiella pneumoniae subsp} SCOP: a.132.1.4 PDB: 3hml_A* 1otv_A 3hnh_A* 1otw_A* Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3bjd_A Putative 3-oxoacyl-(acyl-carrier-protein) synthas; structural genomics, APC5632, 3-oxoacyl-(acyl-carrier-protei synthase, PSI-2; HET: MSE; 1.85A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3b5o_A CADD-like protein of unknown function; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; HET: MSE; 1.35A {Nostoc punctiforme} PDB: 3b5p_A* Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2q32_A Heme oxygenase 2, HO-2; structural genomics medical relevance, structural genomics community request, protein structure in PSI; HET: OXN; 2.40A {Homo sapiens} PDB: 2qpp_A* 2rgz_A* Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1wov_A Heme oxygenase 2; HOMO dimer, oxidoreductase; HET: HEM; 1.75A {Synechocystis SP} SCOP: a.132.1.1 PDB: 1wow_A* 1wox_A* Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1j02_A Heme oxygenase 1; alpha helix, O2-analog bound form, oxidoreductase; HET: HEM; 1.70A {Rattus norvegicus} SCOP: a.132.1.1 PDB: 1irm_C 1dve_A* 1ix3_A* 1ivj_A* 1ix4_A* 1j2c_A* 1ubb_A* 1ulx_A* 1vgi_A* 2dy5_A* 2e7e_A* 2zvu_A* 1dvg_A* 3i9t_A* 3i9u_A* Back     alignment and structure
>1we1_A Heme oxygenase 1; oxidoreductase; HET: HEM; 2.50A {Synechocystis SP} SCOP: a.132.1.1 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>1n45_A Heme oxygenase 1, HO-1; alpha helices, heme-binding site, oxidoreductase; HET: HEM; 1.50A {Homo sapiens} SCOP: a.132.1.1 PDB: 1n3u_A* 1ozr_A* 1ozw_A* 1s13_A* 1s8c_A* 1t5p_A* 1twn_A* 1twr_A* 3czy_A* 3hok_A* 3k4f_A* 3tgm_A* 1xjz_A* 1xk3_A* 1xk2_A* 1ozl_A* 1oyk_A* 1oze_A* 1oyl_A* 1xk0_A* ... Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1wzd_A Heme oxygenase; electron-transfer, artificial metalloprotein; HET: YOK; 1.35A {Corynebacterium diphtheriae} SCOP: a.132.1.1 PDB: 1iw1_A* 1v8x_A* 1iw0_A* 1wzf_A* 1wzg_A* 2z68_A* 3i8r_A* 3moo_A* 1wnw_A* 1wnx_A* 1wnv_A* Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1sk7_A Hypothetical protein PA-HO; heme oxygenase, heme degradation, regioselectivity, oxidored; HET: HEM; 1.60A {Pseudomonas aeruginosa} SCOP: a.132.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 563
d2a2ma1231 a.132.1.3 (A:10-240) Hypothetical protein BT3146 { 9e-42
d2f2ga1215 a.132.1.3 (A:5-219) Seed maturation protein-relate 1e-35
d2gm8a1211 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon 1e-34
d1wwma1180 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 2e-34
d1udda_215 a.132.1.3 (A:) Hypothetical transcriptional regula 3e-33
d1rtwa_206 a.132.1.3 (A:) Putative transcriptional activator 4e-33
d1to9a_225 a.132.1.3 (A:) Transcriptional activator TenA {Bac 4e-32
d1z72a1217 a.132.1.3 (A:4-220) Putative transcriptional regul 2e-31
d1rcwa_213 a.132.1.4 (A:) Hypothetical protein CT610 {Chlamyd 3e-12
d2bdua1291 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III 7e-09
d1otva_254 a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, P 6e-05
>d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 231 Back     information, alignment and structure

class: All alpha proteins
fold: Heme oxygenase-like
superfamily: Heme oxygenase-like
family: TENA/THI-4
domain: Hypothetical protein BT3146
species: Bacteroides thetaiotaomicron [TaxId: 818]
 Score =  147 bits (373), Expect = 9e-42
 Identities = 39/239 (16%), Positives = 83/239 (34%), Gaps = 29/239 (12%)

Query: 7   KSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQ 66
           KS  P  + L  +LW      +V  + + +   +A+G L    +   + QD ++      
Sbjct: 20  KSDVPAADSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLMVQDGYYCFRGRD 79

Query: 67  AYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFL 126
            Y  A  CA D+  +       K      + ++++ + W    A      +    Y ++ 
Sbjct: 80  DYATAATCAQDETLREFFKAKAK---SYDEYNETYHQTWHLREASGLIPGTDIKDYADYE 136

Query: 127 LATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHP 186
              A                   +  + Y    M PC  L+ ++      L      N  
Sbjct: 137 AYVAG------------------SLASPYMCVVMLPCEYLWPWIANF---LDGYTPTNSL 175

Query: 187 YTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPL 245
           Y  WI+          A Q  ++L++    +  ++     ++++ AM  E++ F +  +
Sbjct: 176 YRFWIEWN--GGTPNGAYQMGNMLEQYRDKIDEDKA---VEIFNTAMNYELKVFTSSTI 229


>d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 215 Back     information, alignment and structure
>d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 211 Back     information, alignment and structure
>d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]} Length = 215 Back     information, alignment and structure
>d1rtwa_ a.132.1.3 (A:) Putative transcriptional activator PF1337 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 206 Back     information, alignment and structure
>d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} Length = 225 Back     information, alignment and structure
>d1z72a1 a.132.1.3 (A:4-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]} Length = 217 Back     information, alignment and structure
>d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis [TaxId: 813]} Length = 213 Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Length = 291 Back     information, alignment and structure
>d1otva_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]} Length = 254 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query563
d2a2ma1231 Hypothetical protein BT3146 {Bacteroides thetaiota 100.0
d1to9a_225 Transcriptional activator TenA {Bacillus subtilis 100.0
d1rtwa_206 Putative transcriptional activator PF1337 {Archaeo 100.0
d1udda_215 Hypothetical transcriptional regulator PH1161 {Pyr 100.0
d2f2ga1215 Seed maturation protein-related At3g16990 {Thale c 100.0
d2gm8a1211 TenA homolog PAE0170 {Archaeon Pyrobaculum aerophi 100.0
d1z72a1217 Putative transcriptional regulator SP0716 (SPr0628 100.0
d1wwma1180 Hypothetical protein TTHA0169 (TT2028) {Thermus th 100.0
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 99.95
d1rcwa_213 Hypothetical protein CT610 {Chlamydia trachomatis 99.91
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.87
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.85
d1otva_254 Coenzyme PQQ synthesis protein C, PqqC {Klebsiella 99.77
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.66
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.31
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 98.86
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 98.83
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 98.81
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.78
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 98.76
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 98.76
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 98.75
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 98.61
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 98.56
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 98.53
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 98.5
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 98.49
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 98.45
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.41
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 98.33
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 98.33
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 98.3
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 98.28
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 98.27
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 98.22
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 98.11
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 98.1
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 98.08
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 98.05
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 97.99
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 97.8
d1n45a_214 Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [Tax 97.75
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.71
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 97.7
d1wzda1207 Heme oxygenase HmuO {Corynebacterium diphtheriae [ 97.69
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 97.59
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 97.58
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 97.52
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 97.5
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 97.47
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 97.45
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 97.43
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 97.4
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 97.4
d1we1a_222 Heme oxygenase-1 (HO-1) {Synechocystis sp. [TaxId: 97.34
d1wova1249 Heme oxygenase 2 {Synechocystis sp. pcc 6803 [TaxI 97.31
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 97.17
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 97.09
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 96.85
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 96.28
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 96.21
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 95.37
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 92.49
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 91.88
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 84.35
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 82.75
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 82.39
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 82.28
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 80.86
>d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
class: All alpha proteins
fold: Heme oxygenase-like
superfamily: Heme oxygenase-like
family: TENA/THI-4
domain: Hypothetical protein BT3146
species: Bacteroides thetaiotaomicron [TaxId: 818]
Probab=100.00  E-value=2.1e-43  Score=345.95  Aligned_cols=208  Identities=18%  Similarity=0.290  Sum_probs=187.8

Q ss_pred             CCCCCCCcchHHHHHHHHhHHhHHHhhcCHHHHHhhcCCCCHHHHHHHHHhhHHHHHHHHHHHHHHHhcCCCHHHHHHHH
Q 008499            6 PKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSIS   85 (563)
Q Consensus         6 ~~~~~~~~~~~~~~lw~~~~~~~~~~~~hPFv~~la~GtL~~~~f~~Yl~QD~~yl~~f~r~~~~~~~~a~~~~~~~~l~   85 (563)
                      ..+.++++.+++.+||++..+.|.++++||||++|++||||.++|++||+||++||.+|+|+++++++++++.+.+.++.
T Consensus        19 ~~~~~~~~~~~~~~L~~~~~~i~~~~~~h~Fv~~l~~GtL~~e~F~~YL~QDy~YL~~~~r~~a~~~aka~~~~~~~~~~   98 (231)
T d2a2ma1          19 LKSDVPAADSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLMVQDGYYCFRGRDDYATAATCAQDETLREFFK   98 (231)
T ss_dssp             CCCSCCCTTSHHHHHHHHTHHHHHHHHTSHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSHHHHHHHH
T ss_pred             CCCCCCCCchHHHHHHHHHHHHHHHHHCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHH
Confidence            45678889999999999999999999999999999999999999999999999999999999999999999988777665


Q ss_pred             HHHHHHHHHHHHHHHHHHHhCCCcccccCCChhHHHHHHHHHHHhc-CCCCCCCCCCCCCCchhhhhhhHHHHHHHHHHH
Q 008499           86 ELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATAS-GKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCM  164 (563)
Q Consensus        86 ~~~~~i~~E~~~h~~~~~~~gi~~~~~~~~~p~~~~Y~~fl~~~a~-~~~~~~~~~~~~~~~~~~~~~~a~~l~Al~pC~  164 (563)
                      ..   +..|+++|+.+++++|++..+..+++|+|++|++||++++. |+.                   +++++||+||+
T Consensus        99 ~~---~~~e~~l~~~~~~~~gi~~~~~~~~~p~t~aY~~~l~~~a~~~~~-------------------~~~laallpC~  156 (231)
T d2a2ma1          99 AK---AKSYDEYNETYHQTWHLREASGLIPGTDIKDYADYEAYVAGSLAS-------------------PYMCVVMLPCE  156 (231)
T ss_dssp             HH---HHHHHHHHHHHHHTSCBCCGGGBCCCHHHHHHHHHHHHHHHHSCT-------------------HHHHHHHHHHH
T ss_pred             HH---HHHHHHHHHHHHHHcCCChhhcCCCChHHHHHHHHHHHHHhcCCH-------------------HHHHHHHHHHH
Confidence            44   34588999999999999987778899999999999999996 553                   68999999999


Q ss_pred             HHHHHHHHHHHhhccCCCCcccccccccccCChhHHHHHHHHHHHHHHhhccCCHHHHHHHHHHHHHHHHHHHHhhccC
Q 008499          165 RLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQ  243 (563)
Q Consensus       165 ~~Y~~ig~~~~~~~~~~~~~~~y~~Wi~~y~s~~f~~~v~~l~~~ld~~~~~~~~~~~~~~~~~f~~~~~lE~~Fw~~a  243 (563)
                      |+|.+||+++....   .++++|++||+.|  ++|.+.+.++++++|+++...+   .++++++|.++|++|++||++|
T Consensus       157 w~Y~~ig~~l~~~~---~~~~~y~~WI~~y--~~f~~~v~~~~~~ld~~~~~~~---~e~~~~iF~~~~~lE~~Fwd~A  227 (231)
T d2a2ma1         157 YLWPWIANFLDGYT---PTNSLYRFWIEWN--GGTPNGAYQMGNMLEQYRDKID---EDKAVEIFNTAMNYELKVFTSS  227 (231)
T ss_dssp             HHHHHHHHHHGGGS---CTTSTTHHHHHHH--CSCCHHHHHHHHHHHTTGGGSC---HHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHhcC---CCCCchHHHHHhC--hhHHHHHHHHHHHHHHHhcccC---HHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999997643   4789999999999  4599999999999999986554   4578999999999999999999



>d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rtwa_ a.132.1.3 (A:) Putative transcriptional activator PF1337 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1z72a1 a.132.1.3 (A:4-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis [TaxId: 813]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1otva_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n45a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1wzda1 a.132.1.1 (A:7-213) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1we1a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1wova1 a.132.1.1 (A:2-250) Heme oxygenase 2 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure