Citrus Sinensis ID: 008500

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---
MSEPIILSDEEDQNALETPIQCPYKKIRTGPHPVAPTVLILDDDPTPKKSGFAPSSSSTPSFVAETPMSDVCIIKCTSRSWLDPQIRVSNSDENLAGSSRLVCLESDNECESGSGRVDLGQNELVHSDSDDEKDSEWDLRIGNAGFIQMSGDSSSQPTCSEYDMDLLQDCPEKENFSMEQMGNLLNTKRSLQVNADNRKSTDEAVGKKKKMTKEERMLFMEEKKKKKEEEKLRKAALKAEAAESKKLQKEMQKWAKGKFAQDSIVTEIDAKVVELGSVGGHLLTRFAEKRFKYRIASNPIERSIVWTMPVPEHISQISPQGMEIPYILLIYEAEEFCNLVLNESLMDHVSLVRRHYPSHTICYLTNRLMAHISKKEKERYKNPANNSGWRRPPVEEVLAKLTTHFFRVHSRQCIDEAEVAEHVVGLTSSLASCQFRKKLTRLSVNANGSLISKDSVDKNLIKKSPWLKALVSIPKVQPRYAIAIWKKYPTMKALLSIYMDPSKSVHEKEFLLKDLTVDGLLGDNRKLGEVCSKRVYRILIAQSGSIKTDDIEDGADFFRCQSN
ccccEEccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHcccccHHHHHHHHHHcccEEEEEccccccEEEEEEEccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccCEEECcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccc
**EPIIL*************QCPYKKIRTGPHPVAPTVLIL**************************MSDVCIIKCTSRSWLDPQIR*****************************************************IG********************************************************************************************************************FAQDSIVTEIDAKVVELGSVGGHLLTRFAEKRFKYRIASNPIERSIVWTMPVPEHISQISPQGMEIPYILLIYEAEEFCNLVLNESLMDHVSLVRRHYPSHTICYLTNRLMAHI********************PVEEVLAKLTTHFFRVHSRQCIDEAEVAEHVVGLTSSLASCQFRKKLTRLSVNANGSLISKDSVDKNLIKKSPWLKALVSIPKVQPRYAIAIWKKYPTMKALLSIYMDPSKSVHEKEFLLKDLTVDGLLGDNRKLGEVCSKRVYRILIAQSGSIKTDDIEDGADFF*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEPIILSDEEDQNALETPIQCPYKKIRTGPHPVAPTVLILDDDPTPKKSGFAPSSSSTPSFVAETPMSDVCIIKCTSRSWLDPQIRVSNSDENLAGSSRLVCLESDNECESGSGRVDLGQNELVHSDSDDEKDSEWDLRIGNAGFIQMSGDSSSQPTCSEYDMDLLQDCPEKENFSMEQMGNLLNTKRSLQVNADNRKSTDEAVGKKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQKEMQKWAKGKFAQDSIVTEIDAKVVELGSVGGHLLTRFAEKRFKYRIASNPIERSIVWTMPVPEHISQISPQGMEIPYILLIYEAEEFCNLVLNESLMDHVSLVRRHYPSHTICYLTNRLMAHISKKEKERYKNPANNSGWRRPPVEEVLAKLTTHFFRVHSRQCIDEAEVAEHVVGLTSSLASCQFRKKLTRLSVNANGSLISKDSVDKNLIKKSPWLKALVSIPKVQPRYAIAIWKKYPTMKALLSIYMDPSKSVHEKEFLLKDLTVDGLLGDNRKLGEVCSKRVYRILIAQSGSIKTDDIEDGADFFRCQSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Crossover junction endonuclease EME1B Interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, D-loops, replication forks, nicked Holliday junctions and also intact Holliday junctions with a reduced efficiency. May be required in mitosis for the processing of stalled or collapsed replication fork intermediates. Plays a role in DNA repair and in genotoxic stress-induced homologous recombination (HR) in somatic cells. Mediates a subset of meiotic recombination events that are insensitive to crossover interference.probableC5H8J1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZIU, chain B
Confidence level:very confident
Coverage over the Query: 259-308,320-369,390-550
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 195-273
View the alignment between query and template
View the model in PyMOL