Citrus Sinensis ID: 008558

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-
MGNCCSDTGGGMAAVGGTAGLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESNPSNRPKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPLKDVQSKSPH
cccccccccccccccccccccccccccccccccHHHHccccccccccEEEEEEEcccccccccccccccEEEEEEEcccccEEEEEcEEEEcccccccccEEEEEEEEEccccEEEEEEEEccccccccccccccccccEEEEEEEEEEEcEEccccEEEEEEccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEEccccccccccccccEEEEEEEcccccEEEEEEccEEcccccccEEEEEEEEEEcccccccEEEEEEECcccccccccccccccHHHHHHcccccccccEEEcccccccccccccccEEEcccccccHHHHHcccccEEEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccCCccccccccccEEEEccccccccccccccHHHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHHHccccccEEEEEECcccccHHHHHHcccccccccccccccccccEEEEECcccccccccc
****************************SNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITP*************CGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNG****PDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPL**V******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNCCSDTGGGMAAVGGTAGLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESNPSNRPKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPLKDVQSKSPH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BONZAI 1 Negative regulator of cell death and defense responses. Negative regulator of several R genes, including SNC1. May have effects in promoting growth and development. May function in membrane trafficking and in fusion of vesicles with plasma membrane at low temperature. Exhibits calcium-dependent phospholipid binding properties.probableQ941L3
Copine-3 May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties.probableQ5RAE1
Copine-3 May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties.probableO75131

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R83, chain A
Confidence level:very confident
Coverage over the Query: 47-125,137-167,178-296
View the alignment between query and template
View the model in PyMOL
Template: 3PYC, chain A
Confidence level:very confident
Coverage over the Query: 203-330
View the alignment between query and template
View the model in PyMOL
Template: 3K6S, chain A
Confidence level:confident
Coverage over the Query: 349-433,444-529
View the alignment between query and template
View the model in PyMOL
Template: 1JEY, chain A
Confidence level:probable
Coverage over the Query: 351-521
View the alignment between query and template
View the model in PyMOL