Citrus Sinensis ID: 008558

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-
MGNCCSDTGGGMAAVGGTAGLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESNPSNRPKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPLKDVQSKSPH
cccccccccccccccccccccccccccccccccHHHHccccccccccEEEEEEEcccccccccccccccEEEEEEEcccccEEEEEcEEEEcccccccccEEEEEEEEEccccEEEEEEEEccccccccccccccccccEEEEEEEEEEEcEEccccEEEEEEccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEEccccccccccccccEEEEEEEcccccEEEEEEccEEcccccccEEEEEEEEEEcccccccEEEEEEEEcccccccccccccccHHHHHHcccccccccEEEcccccccccccccccEEEcccccccHHHHHcccccEEEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccEEccccccccccEEEEccccccccccccccHHHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHccccccccccccccccccEEEEEEcccccccccc
ccccccccccccccccccccccccccccccHHHHHHHHHccccccEEEEEEEEEcccccccccccccccEEEEEEEccccEEEEEcccEEEEccccccEEEEEEEEEEEEEEEEEEEEEEEEcccccccccccccccccccccEEEEEHHHEEcccccEEEEEccccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEEEccccccccccccccEEEEEEEcccccEEEEEEEEEEEcccccccEcEEEEHHHHccccccEEEEEEEccccccccEEEEEHHHHHHHHHHccccccEEEEccHHHHHccccccccEEEEEEEEEEEEEcHHHHHccccEEEEEEEEEEEccccccccccccEEEcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccEccHHHHHHHHHHHcccccEEEEEEcccccHHHHHEcccccccEEEcccccEcHHHHEEEccHHHHcccccc
mgnccsdtgggmaavggTAGLSynaaassnDAVDWFLKsrgylglfSQIELSFsaadlrdrdvlsksdpMLVVYMKARDGALVEVGRTEVVlnslnptwitKHIITYQFEVVQTLVFRIYDvdtqfhnvdVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVrreetitpiteesnpsnrpkhcgklTVHAEECINSKTTTELILRCsdldckdlfsrndpfLVISKIVesgthipvcktevlknetkptWKSVFLNIqqvgskdspliiecfnfnsngkhdLIGKVQKSLADLEKlhssgqgqnLFLStaagnnnhkilNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFtasngnprlpdslhyldpsgrpnaYQRAILEVGEVlqvydsdkrfpawgfgarpidgpvshcfnlngsnsycevegipGIMMAYTSALHnvnlagptlfgpvisnAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVkasdlplsILIIGvggadfkemeildadkgerlesstgrvasrdivqfvplkdvqsksph
MGNCCSDTGGGMAAVGGTAGLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFsaadlrdrdvlsksdpMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEatctlsqivtrknrsltldlvrreetitpiteesnpsnrpkhcGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKivesgthipvcktevlknetkptWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDAlvkasdlplSILIIGVGGADFKEMEILDADkgerlesstgrvasrdivqfvplkdvqsksph
MGNCCSDtgggmaavggtagLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRReetitpiteeSNPSNRPKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPLKDVQSKSPH
************AAVGGTAGLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRR*******************CGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLAD***********NLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNG*******LHYLD***RPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEIL*******************IVQF************
**NC*S****************************WFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVT*****LTLDLVRREETITP*******************HAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASN*****PDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPL**V******
********GGGMAAVGGTAGLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPIT**********HCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPL*********
****************************SNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRR****************PKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPLKDVQS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNCCSDTGGGMAAVGGTAGLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESNPSNRPKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPLKDVQSKSPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query561 2.2.26 [Sep-21-2011]
Q941L3578 Protein BONZAI 1 OS=Arabi no no 0.971 0.942 0.710 0.0
Q5S1W2586 Protein BONZAI 2 OS=Arabi no no 0.976 0.935 0.687 0.0
Q5XQC7584 Protein BONZAI 3 OS=Arabi no no 0.967 0.929 0.583 0.0
O75131537 Copine-3 OS=Homo sapiens yes no 0.862 0.901 0.434 1e-102
Q8BT60533 Copine-3 OS=Mus musculus yes no 0.862 0.908 0.430 1e-100
Q5RAE1537 Copine-3 OS=Pongo abelii yes no 0.862 0.901 0.426 4e-99
Q99829537 Copine-1 OS=Homo sapiens no no 0.848 0.886 0.417 2e-97
Q8JZW4593 Copine-5 OS=Mus musculus no no 0.877 0.829 0.414 2e-97
Q9HCH3593 Copine-5 OS=Homo sapiens no no 0.877 0.829 0.412 8e-97
Q8IYJ1553 Copine-9 OS=Homo sapiens no no 0.866 0.878 0.396 2e-95
>sp|Q941L3|BON1_ARATH Protein BONZAI 1 OS=Arabidopsis thaliana GN=BON1 PE=1 SV=2 Back     alignment and function desciption
 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/557 (71%), Positives = 460/557 (82%), Gaps = 12/557 (2%)

Query: 1   MGNCCSDTGGGMAAVGGTAGLSYNAA-ASSNDAVDWFLKSRGYLGLFSQIELSFSAADLR 59
           MGNCCSD   G  A  G  G   +AA  ++NDA+D++LKS+G+ GLFSQIELSFSA++LR
Sbjct: 1   MGNCCSDVASGAGATAGVGGSGSSAALGATNDALDYYLKSKGFNGLFSQIELSFSASNLR 60

Query: 60  DRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRI 119
           DRDVLSKSDPM+VVY K +D  L EV R+EVVLNSL P WI K I+ Y FE VQTLVFR+
Sbjct: 61  DRDVLSKSDPMVVVYQKEKDATLSEVFRSEVVLNSLAPKWIKKFIVAYHFETVQTLVFRV 120

Query: 120 YDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESN 179
           YDVDT+F N   + LKL EQQFLGEATC LS+I+T+  R+ TL+L R++           
Sbjct: 121 YDVDTKFQNSREEMLKLDEQQFLGEATCALSEIITKSTRTSTLELKRKDGFA-------- 172

Query: 180 PSNRPKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIP 239
           P  +P H GKL +HAEE + SK +TE++ RCS+L+ KDLFS++DPFLV+SKIVE GT IP
Sbjct: 173 PQAQPHH-GKLIIHAEESLASKISTEIVFRCSNLESKDLFSKSDPFLVVSKIVEHGTPIP 231

Query: 240 VCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEK 299
           V KTEV KN+  P WK VFL++QQVGSKDSP+IIEC +FNSNGKH LIGKVQKSL+DLEK
Sbjct: 232 VSKTEVRKNDLNPIWKPVFLSVQQVGSKDSPVIIECSDFNSNGKHSLIGKVQKSLSDLEK 291

Query: 300 LHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFT 359
           LH +GQG N  L T AG N  K+L SQLFVDKF+E+V +TFL+YLA GFELNFMVA+DFT
Sbjct: 292 LHLAGQGINFSLPTGAGQN--KVLKSQLFVDKFTETVHHTFLEYLASGFELNFMVAIDFT 349

Query: 360 ASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSH 419
           ASNGNPRLPDSLHY+DPSGR NAYQRAI++VGEVLQ YDSDKRFPAWGFGARPID PVSH
Sbjct: 350 ASNGNPRLPDSLHYIDPSGRLNAYQRAIMDVGEVLQFYDSDKRFPAWGFGARPIDAPVSH 409

Query: 420 CFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKY 479
           CFNLNGS+SY EV+GI GIM +YTSAL NV+LAGPTLFGPVI+ AA+IA  SLA   +KY
Sbjct: 410 CFNLNGSSSYSEVDGIQGIMTSYTSALFNVSLAGPTLFGPVINAAAMIASASLAQGSRKY 469

Query: 480 FVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTG 539
           +VLLIITDGV+TDLQETKDALV ASDLPLSILI+GVGGADFKEMEILDADKGERLESS+G
Sbjct: 470 YVLLIITDGVITDLQETKDALVSASDLPLSILIVGVGGADFKEMEILDADKGERLESSSG 529

Query: 540 RVASRDIVQFVPLKDVQ 556
           R+ASRDIVQFV L+DVQ
Sbjct: 530 RLASRDIVQFVALRDVQ 546
Negative regulator of cell death and defense responses. Negative regulator of several R genes, including SNC1. May have effects in promoting growth and development. May function in membrane trafficking and in fusion of vesicles with plasma membrane at low temperature. Exhibits calcium-dependent phospholipid binding properties.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5S1W2|BON2_ARATH Protein BONZAI 2 OS=Arabidopsis thaliana GN=BON2 PE=1 SV=2 Back     alignment and function description
>sp|Q5XQC7|BON3_ARATH Protein BONZAI 3 OS=Arabidopsis thaliana GN=BON3 PE=1 SV=1 Back     alignment and function description
>sp|O75131|CPNE3_HUMAN Copine-3 OS=Homo sapiens GN=CPNE3 PE=1 SV=1 Back     alignment and function description
>sp|Q8BT60|CPNE3_MOUSE Copine-3 OS=Mus musculus GN=Cpne3 PE=1 SV=2 Back     alignment and function description
>sp|Q5RAE1|CPNE3_PONAB Copine-3 OS=Pongo abelii GN=CPNE3 PE=2 SV=1 Back     alignment and function description
>sp|Q99829|CPNE1_HUMAN Copine-1 OS=Homo sapiens GN=CPNE1 PE=1 SV=1 Back     alignment and function description
>sp|Q8JZW4|CPNE5_MOUSE Copine-5 OS=Mus musculus GN=Cpne5 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCH3|CPNE5_HUMAN Copine-5 OS=Homo sapiens GN=CPNE5 PE=1 SV=2 Back     alignment and function description
>sp|Q8IYJ1|CPNE9_HUMAN Copine-9 OS=Homo sapiens GN=CPNE9 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query561
356527466580 PREDICTED: protein BONZAI 1-like [Glycin 0.978 0.946 0.777 0.0
225456493576 PREDICTED: protein BONZAI 1 [Vitis vinif 0.971 0.946 0.792 0.0
317106620577 JHL07K02.17 [Jatropha curcas] 0.976 0.949 0.781 0.0
255540043577 copine, putative [Ricinus communis] gi|2 0.973 0.946 0.768 0.0
147785841579 hypothetical protein VITISV_032389 [Viti 0.971 0.941 0.770 0.0
356516476578 PREDICTED: protein BONZAI 1-like [Glycin 0.976 0.948 0.749 0.0
356507392 1494 PREDICTED: uncharacterized protein LOC10 0.976 0.366 0.745 0.0
449478066582 PREDICTED: protein BONZAI 2-like [Cucumi 0.976 0.941 0.753 0.0
224119840576 predicted protein [Populus trichocarpa] 0.971 0.946 0.772 0.0
449431932582 PREDICTED: LOW QUALITY PROTEIN: protein 0.976 0.941 0.75 0.0
>gi|356527466|ref|XP_003532331.1| PREDICTED: protein BONZAI 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/558 (77%), Positives = 494/558 (88%), Gaps = 9/558 (1%)

Query: 1   MGNCCSDTGGGMAAVGGTAGLSYNAAASSNDAVDWFLKSRGYLGLFSQIELSFSAADLRD 60
           MGNCCSD  GG +A+GGTA    N A + NDAVD FL+SRGY GLFSQIELSFSA+ LRD
Sbjct: 1   MGNCCSDVAGGQSAIGGTAAGHLNPANAPNDAVDRFLRSRGYNGLFSQIELSFSASGLRD 60

Query: 61  RDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIY 120
           RDVLSKSDPM+V+Y + ++ AL E+GRTEV+LNSLNPTWITKH + Y FEVVQ LVFR+Y
Sbjct: 61  RDVLSKSDPMMVLYARGKNAALTELGRTEVILNSLNPTWITKHTLIYNFEVVQVLVFRVY 120

Query: 121 DVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESNP 180
           DVDTQFHN+DVK LKL EQQ+LGEATC LS+I+T+ +RS+TLDL RRE++I         
Sbjct: 121 DVDTQFHNIDVKMLKLEEQQYLGEATCALSEIITKFDRSMTLDLHRREDSIR-------- 172

Query: 181 SNRPKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPV 240
           S + ++CGKL VHAEEC++SKTT E+ILRCSDL+ +DLFSR+DPFL++SK+VE G+HIP+
Sbjct: 173 STQSQNCGKLLVHAEECVSSKTTIEMILRCSDLEYRDLFSRSDPFLLLSKVVEGGSHIPI 232

Query: 241 CKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEKL 300
           CKTEV+KN+  P WK VFLNIQQVGSK+SPLIIEC+NFNSNGKHDL+GKVQKSL +LEKL
Sbjct: 233 CKTEVIKNDHNPIWKPVFLNIQQVGSKESPLIIECYNFNSNGKHDLMGKVQKSLVELEKL 292

Query: 301 HSSGQGQNLFLSTAAGNNNH-KILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFT 359
           +S GQG+N   S  AG+N+H K+L SQLFVDKFSES+QY+FLDYLAGGFELNFMVA+DFT
Sbjct: 293 YSGGQGENFISSAPAGHNSHNKVLKSQLFVDKFSESIQYSFLDYLAGGFELNFMVAIDFT 352

Query: 360 ASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSH 419
           ASNGNPRLPDSLHY+DPSGRPNAYQRA+LEVGEVLQ YDSDKRFP WGFGARPID PVSH
Sbjct: 353 ASNGNPRLPDSLHYIDPSGRPNAYQRAVLEVGEVLQYYDSDKRFPTWGFGARPIDAPVSH 412

Query: 420 CFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKY 479
           CFNLNGS+  CEVEGI GIMMAYTSAL NV+LAGPTLFGPVISNAALIA QS+AN G+KY
Sbjct: 413 CFNLNGSSHCCEVEGIQGIMMAYTSALLNVSLAGPTLFGPVISNAALIASQSVANGGRKY 472

Query: 480 FVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTG 539
           FVLLIITDGVVTDLQETKDALVKASDLPLSILI+GVGGADFKEMEILDADKGERLESS+G
Sbjct: 473 FVLLIITDGVVTDLQETKDALVKASDLPLSILIVGVGGADFKEMEILDADKGERLESSSG 532

Query: 540 RVASRDIVQFVPLKDVQS 557
           RVASRDIVQFVP +DVQS
Sbjct: 533 RVASRDIVQFVPFRDVQS 550

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225456493|ref|XP_002280913.1| PREDICTED: protein BONZAI 1 [Vitis vinifera] gi|297734511|emb|CBI15758.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|317106620|dbj|BAJ53127.1| JHL07K02.17 [Jatropha curcas] Back     alignment and taxonomy information
>gi|255540043|ref|XP_002511086.1| copine, putative [Ricinus communis] gi|223550201|gb|EEF51688.1| copine, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147785841|emb|CAN73077.1| hypothetical protein VITISV_032389 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356516476|ref|XP_003526920.1| PREDICTED: protein BONZAI 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356507392|ref|XP_003522451.1| PREDICTED: uncharacterized protein LOC100798141 [Glycine max] Back     alignment and taxonomy information
>gi|449478066|ref|XP_004155212.1| PREDICTED: protein BONZAI 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224119840|ref|XP_002318175.1| predicted protein [Populus trichocarpa] gi|222858848|gb|EEE96395.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449431932|ref|XP_004133754.1| PREDICTED: LOW QUALITY PROTEIN: protein BONZAI 2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query561
TAIR|locus:2156186578 BON1 "AT5G61900" [Arabidopsis 0.971 0.942 0.703 2e-205
TAIR|locus:2183299586 BON2 "AT5G07300" [Arabidopsis 0.976 0.935 0.682 1.9e-202
TAIR|locus:2036074584 BON3 "AT1G08860" [Arabidopsis 0.925 0.888 0.600 1.9e-170
UNIPROTKB|O75131537 CPNE3 "Copine-3" [Homo sapiens 0.732 0.765 0.438 1.9e-104
UNIPROTKB|F1RXD5533 CPNE3 "Uncharacterized protein 0.732 0.771 0.436 1.9e-104
UNIPROTKB|E2QZQ6537 CPNE3 "Uncharacterized protein 0.732 0.765 0.433 1.7e-103
UNIPROTKB|E2R0K3533 CPNE3 "Uncharacterized protein 0.732 0.771 0.433 1.7e-103
UNIPROTKB|A5PJY9533 CPNE3 "Uncharacterized protein 0.732 0.771 0.431 3.6e-103
UNIPROTKB|E1BQA5539 CPNE3 "Uncharacterized protein 0.736 0.766 0.428 1.5e-102
MGI|MGI:1917818533 Cpne3 "copine III" [Mus muscul 0.732 0.771 0.429 8.4e-102
TAIR|locus:2156186 BON1 "AT5G61900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1987 (704.5 bits), Expect = 2.0e-205, P = 2.0e-205
 Identities = 392/557 (70%), Positives = 455/557 (81%)

Query:     1 MGNCCSDXXXXXXXXXXXXXLSYNAA-ASSNDAVDWFLKSRGYLGLFSQIELSFSAADLR 59
             MGNCCSD                +AA  ++NDA+D++LKS+G+ GLFSQIELSFSA++LR
Sbjct:     1 MGNCCSDVASGAGATAGVGGSGSSAALGATNDALDYYLKSKGFNGLFSQIELSFSASNLR 60

Query:    60 DRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRI 119
             DRDVLSKSDPM+VVY K +D  L EV R+EVVLNSL P WI K I+ Y FE VQTLVFR+
Sbjct:    61 DRDVLSKSDPMVVVYQKEKDATLSEVFRSEVVLNSLAPKWIKKFIVAYHFETVQTLVFRV 120

Query:   120 YDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRRXXXXXXXXXXSN 179
             YDVDT+F N   + LKL EQQFLGEATC LS+I+T+  R+ TL+L R+            
Sbjct:   121 YDVDTKFQNSREEMLKLDEQQFLGEATCALSEIITKSTRTSTLELKRKDGFA-------- 172

Query:   180 PSNRPKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIP 239
             P  +P H GKL +HAEE + SK +TE++ RCS+L+ KDLFS++DPFLV+SKIVE GT IP
Sbjct:   173 PQAQPHH-GKLIIHAEESLASKISTEIVFRCSNLESKDLFSKSDPFLVVSKIVEHGTPIP 231

Query:   240 VCKTEVLKNETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEK 299
             V KTEV KN+  P WK VFL++QQVGSKDSP+IIEC +FNSNGKH LIGKVQKSL+DLEK
Sbjct:   232 VSKTEVRKNDLNPIWKPVFLSVQQVGSKDSPVIIECSDFNSNGKHSLIGKVQKSLSDLEK 291

Query:   300 LHSSGQGQNLFLSTAAGNNNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFT 359
             LH +GQG N  L T AG N  K+L SQLFVDKF+E+V +TFL+YLA GFELNFMVA+DFT
Sbjct:   292 LHLAGQGINFSLPTGAGQN--KVLKSQLFVDKFTETVHHTFLEYLASGFELNFMVAIDFT 349

Query:   360 ASNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSH 419
             ASNGNPRLPDSLHY+DPSGR NAYQRAI++VGEVLQ YDSDKRFPAWGFGARPID PVSH
Sbjct:   350 ASNGNPRLPDSLHYIDPSGRLNAYQRAIMDVGEVLQFYDSDKRFPAWGFGARPIDAPVSH 409

Query:   420 CFNLNGSNSYCEVEGIPGIMMAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKY 479
             CFNLNGS+SY EV+GI GIM +YTSAL NV+LAGPTLFGPVI+ AA+IA  SLA   +KY
Sbjct:   410 CFNLNGSSSYSEVDGIQGIMTSYTSALFNVSLAGPTLFGPVINAAAMIASASLAQGSRKY 469

Query:   480 FVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTG 539
             +VLLIITDGV+TDLQETKDALV ASDLPLSILI+GVGGADFKEMEILDADKGERLESS+G
Sbjct:   470 YVLLIITDGVITDLQETKDALVSASDLPLSILIVGVGGADFKEMEILDADKGERLESSSG 529

Query:   540 RVASRDIVQFVPLKDVQ 556
             R+ASRDIVQFV L+DVQ
Sbjct:   530 RLASRDIVQFVALRDVQ 546
GO:0005544 "calcium-dependent phospholipid binding" evidence=ISS;IDA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0009626 "plant-type hypersensitive response" evidence=NAS
GO:0010186 "positive regulation of cellular defense response" evidence=NAS
GO:0019725 "cellular homeostasis" evidence=IMP;NAS
GO:0009266 "response to temperature stimulus" evidence=IEP
GO:0045793 "positive regulation of cell size" evidence=IMP
GO:0009270 "response to humidity" evidence=IMP
GO:0060548 "negative regulation of cell death" evidence=IMP
GO:0009506 "plasmodesma" evidence=IDA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009690 "cytokinin metabolic process" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0045087 "innate immune response" evidence=RCA
TAIR|locus:2183299 BON2 "AT5G07300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036074 BON3 "AT1G08860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O75131 CPNE3 "Copine-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXD5 CPNE3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZQ6 CPNE3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0K3 CPNE3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJY9 CPNE3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQA5 CPNE3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1917818 Cpne3 "copine III" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O75131CPNE3_HUMANNo assigned EC number0.43430.86270.9013yesno
Q5RAE1CPNE3_PONABNo assigned EC number0.42660.86270.9013yesno
Q941L3BON1_ARATHNo assigned EC number0.71090.97140.9429nono
Q8BT60CPNE3_MOUSENo assigned EC number0.43050.86270.9080yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
cd01459254 cd01459, vWA_copine_like, VWA Copine: Copines are 1e-111
pfam07002146 pfam07002, Copine, Copine 2e-67
cd04048120 cd04048, C2A_Copine, C2 domain first repeat in Cop 6e-42
cd04047110 cd04047, C2B_Copine, C2 domain second repeat in Co 5e-32
cd04047110 cd04047, C2B_Copine, C2 domain second repeat in Co 6e-14
smart00239101 smart00239, C2, Protein kinase C conserved region 6e-12
cd00030102 cd00030, C2, C2 domain 3e-10
cd00030102 cd00030, C2, C2 domain 4e-10
pfam0016885 pfam00168, C2, C2 domain 2e-09
pfam0016885 pfam00168, C2, C2 domain 4e-09
smart00327175 smart00327, VWA, von Willebrand factor (vWF) type 4e-09
cd04048120 cd04048, C2A_Copine, C2 domain first repeat in Cop 6e-09
smart00239101 smart00239, C2, Protein kinase C conserved region 7e-09
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 8e-06
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 2e-05
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 4e-05
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 8e-04
>gnl|CDD|238736 cd01459, vWA_copine_like, VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium Back     alignment and domain information 
 Score =  330 bits (849), Expect = e-111
 Identities = 124/240 (51%), Positives = 148/240 (61%), Gaps = 6/240 (2%)

Query: 321 KILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTASNGNPRLPDSLHYLDPSGRP 380
           K+  S   V      VQ TFLDY + G E N +VA+DFT SNG P    SLHY+ P GR 
Sbjct: 3   KVYKSSGEVTLTDCRVQPTFLDYRSAGLESNLIVAIDFTKSNGWPGEKRSLHYISP-GRL 61

Query: 381 NAYQRAILEVGEVLQVYDSDKRFPAWGFGARPIDGPVSHCFNLNGSNSYCEVEGIPGIMM 440
           N YQ+AI  VGEVLQ YDSDK  PA+GFGA          F   G +   E +G  G++ 
Sbjct: 62  NPYQKAIRIVGEVLQPYDSDKLIPAFGFGAIVTKDQSVFSFFP-GYSESPECQGFEGVLR 120

Query: 441 AYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDAL 500
           AY  AL NV+L+GPT F PVI  AA IA  S  N   KY +LLIITDG +TD+ ET  A+
Sbjct: 121 AYREALPNVSLSGPTNFAPVIRAAANIAKAS--NSQSKYHILLIITDGEITDMNETIKAI 178

Query: 501 VKASDLPLSILIIGVGGADFKEMEILDADKGERLESSTGRVASRDIVQFVPLKDVQSKSP 560
           V+AS  PLSI+I+GVG   F  ME LD D G  LESS GR+A+RDIVQFVP  +  S + 
Sbjct: 179 VEASKYPLSIVIVGVGDGPFDAMERLDDDDG--LESSDGRIATRDIVQFVPFTEFMSNAG 236

They are found in human and orthologues have been found in C. elegans and Arabidopsis Thaliana. None have been found in D. Melanogaster or S. Cereviciae. Phylogenetic distribution suggests that copines have been lost in some eukaryotes. No functional properties have been assigned to the VWA domains present in copines. The members of this subgroup contain a functional MIDAS motif based on their preferential binding to magnesium and manganese. However, the MIDAS motif is not totally conserved, in most cases the MIDAS consists of the sequence DxTxS instead of the motif DxSxS that is found in most cases. The C2 domains present in copines mediate phospholipid binding. Length = 254
>gnl|CDD|219263 pfam07002, Copine, Copine Back     alignment and domain information
>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine Back     alignment and domain information
>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine Back     alignment and domain information
>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 561
KOG1327529 consensus Copine [Signal transduction mechanisms] 100.0
cd01459254 vWA_copine_like VWA Copine: Copines are phospholip 100.0
PF07002146 Copine: Copine; InterPro: IPR010734 This represent 100.0
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.93
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.83
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand fa 99.79
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.79
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.76
PF10138200 vWA-TerF-like: vWA found in TerF C terminus ; Inte 99.73
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.71
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.7
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.69
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.69
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.68
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.68
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.68
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.68
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.67
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.67
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.67
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.66
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.66
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.66
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.65
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.65
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.65
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.65
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.65
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.64
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.64
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.64
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.63
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.63
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.63
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.63
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.63
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.62
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.62
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.62
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.62
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.62
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.62
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.62
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.62
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.62
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.62
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.62
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.62
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.62
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.61
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.61
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.61
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.61
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.61
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.61
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.61
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.6
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.6
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.6
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.6
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.6
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.59
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.59
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.59
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.59
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.59
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.59
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.59
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.58
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.58
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.58
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.58
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.58
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.58
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.58
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.58
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.57
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.57
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.57
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.57
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.57
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.57
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.57
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.57
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.57
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.57
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.56
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.56
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.56
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.56
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.56
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.56
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.56
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.55
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.55
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.55
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.55
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.55
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.55
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.55
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.55
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.54
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.54
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.54
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.54
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.54
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.54
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.53
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.53
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.53
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.53
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.53
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.52
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.52
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.52
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.52
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.52
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.52
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.51
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.51
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.51
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.51
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.51
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.51
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.5
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.5
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.5
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.5
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.5
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.5
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.49
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.49
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.49
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.49
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.49
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.49
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.49
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.49
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.49
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.48
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.48
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.47
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.47
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.46
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.46
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.46
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.46
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.45
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.45
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.44
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.44
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.44
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.44
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.43
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.43
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.43
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.43
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.43
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.42
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.42
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.42
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.42
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.41
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.41
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.41
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.41
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.4
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.4
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.39
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.39
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.39
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.39
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.38
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.38
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.38
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.37
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.37
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.36
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.36
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.36
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.36
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.34
PLN03008 868 Phospholipase D delta 99.34
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.32
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.3
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.29
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.28
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.28
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.27
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.26
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.24
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.23
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.22
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.22
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.21
KOG1327529 consensus Copine [Signal transduction mechanisms] 99.2
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.19
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.13
PLN03008 868 Phospholipase D delta 99.12
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.08
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.05
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.0
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 98.97
cd00030102 C2 C2 domain. The C2 domain was first identified i 98.96
PLN032002102 cellulose synthase-interactive protein; Provisiona 98.95
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 98.93
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 98.89
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 98.83
PLN02223537 phosphoinositide phospholipase C 98.75
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 98.71
cd00030102 C2 C2 domain. The C2 domain was first identified i 98.7
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.66
PLN02952599 phosphoinositide phospholipase C 98.65
KOG13261105 consensus Membrane-associated protein FER-1 and re 98.56
PLN02270 808 phospholipase D alpha 98.53
PLN02230598 phosphoinositide phospholipase C 4 98.51
PLN02222581 phosphoinositide phospholipase C 2 98.49
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 98.44
PLN02228567 Phosphoinositide phospholipase C 98.43
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.32
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.31
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA 98.31
PLN02223537 phosphoinositide phospholipase C 98.3
PLN02952599 phosphoinositide phospholipase C 98.26
PLN02228567 Phosphoinositide phospholipase C 98.22
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.19
cd01471186 vWA_micronemal_protein Micronemal proteins: The To 98.18
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.17
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.12
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.11
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha tr 98.1
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel li 98.09
PLN02230598 phosphoinositide phospholipase C 4 98.05
PLN02222581 phosphoinositide phospholipase C 2 97.99
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 97.95
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (v 97.94
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was 97.93
KOG0169746 consensus Phosphoinositide-specific phospholipase 97.9
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor t 97.87
PLN02270 808 phospholipase D alpha 97.86
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 97.82
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact 97.78
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor 97.77
cd01454174 vWA_norD_type norD type: Denitrifying bacteria con 97.68
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extrace 97.57
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebr 97.56
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor 97.56
PF13519172 VWA_2: von Willebrand factor type A domain; PDB: 3 97.55
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI 97.5
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 97.49
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 97.45
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 97.44
PTZ00441 576 sporozoite surface protein 2 (SSP2); Provisional 97.38
PLN02352 758 phospholipase D epsilon 97.36
cd01470198 vWA_complement_factors Complement factors B and C2 97.35
TIGR03788 596 marine_srt_targ marine proteobacterial sortase tar 97.33
KOG12641267 consensus Phospholipase C [Lipid transport and met 97.3
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: 97.23
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor 97.17
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 97.17
cd01472164 vWA_collagen von Willebrand factor (vWF) type A do 97.16
cd01453183 vWA_transcription_factor_IIH_type Transcription fa 97.15
cd01469177 vWA_integrins_alpha_subunit Integrins are a class 97.15
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi 97.14
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand 97.09
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch 97.07
cd01460266 vWA_midasin VWA_Midasin: Midasin is a member of th 97.07
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor 96.93
PRK13685326 hypothetical protein; Provisional 96.82
PF13768155 VWA_3: von Willebrand factor type A domain 96.81
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V 96.63
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 96.59
PF00092178 VWA: von Willebrand factor type A domain; InterPro 96.55
PLN02964644 phosphatidylserine decarboxylase 96.55
cd01458218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter 96.5
PLN02964 644 phosphatidylserine decarboxylase 96.47
PF09967126 DUF2201: VWA-like domain (DUF2201); InterPro: IPR0 96.26
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 96.01
TIGR03436296 acidobact_VWFA VWFA-related Acidobacterial domain. 95.88
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 95.86
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 95.52
PRK13406584 bchD magnesium chelatase subunit D; Provisional 95.52
KOG3837523 consensus Uncharacterized conserved protein, conta 95.0
PLN02352 758 phospholipase D epsilon 94.98
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 94.37
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vW 94.31
PRK10997487 yieM hypothetical protein; Provisional 93.49
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 92.47
TIGR00868 863 hCaCC calcium-activated chloride channel protein 1 91.41
KOG12651189 consensus Phospholipase C [Lipid transport and met 90.86
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 90.83
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 90.16
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 90.08
KOG3837523 consensus Uncharacterized conserved protein, conta 88.58
cd08397159 C2_PI3K_class_III C2 domain present in class III p 88.32
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 88.15
cd08397159 C2_PI3K_class_III C2 domain present in class III p 86.44
KOG4428 813 consensus Inositol-polyphosphate 4-phosphatase [Si 86.1
PF05762222 VWA_CoxE: VWA domain containing CoxE-like protein; 85.54
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 85.38
PF11775219 CobT_C: Cobalamin biosynthesis protein CobT VWA do 85.32
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis 84.19
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 83.85
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 82.56
PF15627156 CEP76-C2: CEP76 C2 domain 80.56
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 80.54
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-113  Score=898.48  Aligned_cols=474  Identities=48%  Similarity=0.775  Sum_probs=433.2

Q ss_pred             CCCCCCCCCCCCcEEEEEEEc-------------CCCceeeEeeeeeecCCCCCceeeeEEEEEeeCceeEEEEEEEEcc
Q 008558           57 DLRDRDVLSKSDPMLVVYMKA-------------RDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVD  123 (561)
Q Consensus        57 ~L~~~D~~sksDPyv~v~~~~-------------~~~~~~~~~rTevi~n~lNP~w~e~f~i~~~fe~~q~L~~~VyD~D  123 (561)
                      +|.+.|..+++||.|.+....             .++.|.+++|||+|.+.+||.|.++|.+.|.||+.|.|+|.+||.+
T Consensus         1 ~~~~~d~~~~~~~~c~~~~~~s~~~~~~~~~l~~~~~~~~e~~rte~i~~~~~p~f~~~~~l~y~fE~vQ~l~~~~~~~~   80 (529)
T KOG1327|consen    1 NLMAYDIFSKSDPICKLFYLTSGGAWLETLELTKEDDVWEEVGRTEVIRNVLNPFFTKKFLLQYRFEKVQLLRFEVYDID   80 (529)
T ss_pred             CccccccccccCceeeeeccCCCccccccccccccccccccccceeeeeccCCccceeeechhheeeeeeeEEEEEeecC
Confidence            356678889999999987632             3456788999999999999999999999999999999999999998


Q ss_pred             CCcccccccccccccceeeeeeEeechhhhccCCeeEEEEccccccccccccccCCCCCCCcccceEEeecceecccccc
Q 008558          124 TQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESNPSNRPKHCGKLTVHAEECINSKTT  203 (561)
Q Consensus       124 ~~~~~~~~~~~~l~~~d~LG~~~~~L~el~~~~~~~~~~~L~~~~~~i~~~~~~~~~~~~~~~~G~I~i~~e~i~~~~~~  203 (561)
                      ..       ..++..+||+|+++|.+++++.......-+.++.           .    +....|+|++.+++.......
T Consensus        81 ~~-------~~~l~~~dflg~~~c~l~~ivs~~~~~~~l~~~~-----------~----~~~~~g~iti~aee~~~~~~~  138 (529)
T KOG1327|consen   81 SR-------TPDLSSADFLGTAECTLSQIVSSSGLTGPLLLKP-----------G----KNAGSGTITISAEEDESDNDV  138 (529)
T ss_pred             Cc-------cCCcchhcccceeeeehhhhhhhhhhhhhhhccc-----------C----ccCCcccEEEEeecccccCce
Confidence            75       2267789999999999999997654433222322           1    225579999999998888889


Q ss_pred             ceeEeeecCCCcCCCCCCCCceEEEEEEcCCCceeeEEEceeecCCCCCceecceeeeeec--CCCCccEEEEEEeccCC
Q 008558          204 TELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKSVFLNIQQV--GSKDSPLIIECFNFNSN  281 (561)
Q Consensus       204 v~~~i~a~nL~~~d~~g~sDPy~~i~~~~~~g~~~~~~kTevik~tlnP~W~ef~~~~~~l--~d~~~~L~ieV~D~d~~  281 (561)
                      +.+.++|++|.++|+++++|||+.+++..++++|..+|+||+++++++|.|.+|.++.+.+  .+.+++++++|||++..
T Consensus       139 ~~~~~~~~~ld~kd~f~ksd~~l~~~~~~~d~s~~~~~~tEv~~n~l~p~w~~~~i~~~~l~~~~~~~~~~i~~~d~~~~  218 (529)
T KOG1327|consen  139 VQFSFRAKNLDPKDFFSKSDPYLEFYKRVDDGSTQMLYRTEVVKNTLNPQWAPFSISLQSLCSKDGNRPIQIECYDYDSN  218 (529)
T ss_pred             eeeeeeeeecCcccccccCCcceEEEEecCCCceeeccccceeccCCCCcccccccchhhhcccCCCCceEEEEeccCCC
Confidence            9999999999999999999999999999888999999999999999999999999998888  56789999999999999


Q ss_pred             CCCceeEEEEEehhhHhhccCCCceeeeecccccCC-CCcccccccEEEeEeeeeeeeeeeeccccceeeeEEEEEcccc
Q 008558          282 GKHDLIGKVQKSLADLEKLHSSGQGQNLFLSTAAGN-NNHKILNSQLFVDKFSESVQYTFLDYLAGGFELNFMVAVDFTA  360 (561)
Q Consensus       282 g~~d~IG~~~i~l~~l~~~~~~~~~~~l~n~~~~~K-~~~~~~~G~i~l~~~~~~~~~sFldyi~gG~qi~~~vaIDfT~  360 (561)
                      ++|++||++.+++.+++. .+....+++++++++.| ++|++ +|++.+..|+....+||+|||.||+|+||+||||||+
T Consensus       219 ~~~~~ig~~~tt~~~~~~-~~~~~~~~~~~~~~~~~~k~~k~-~g~~~l~~~~~~~~~sfld~i~gg~~lnf~vgIDfTa  296 (529)
T KOG1327|consen  219 GKHDLIGKFQTTLSELQE-PGSPNQIMLINPKKKAKKKSYKN-SGQLILDRFTSLDQYSFLDYIAGGEQLNFTVGIDFTA  296 (529)
T ss_pred             CCcCceeEecccHHHhcc-cCCcccccccChhhhhhhhcccc-cceEEehheeehhhhhHHHHHccCceeeeEEEEEEec
Confidence            999999999999999974 55567889999887654 46787 9999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCccccCCCCCCCHHHHHHHHHhhhcccccCCCCcceeeeccc-CCCCCceeEEeCCCCCCCCcccCHHHHH
Q 008558          361 SNGNPRLPDSLHYLDPSGRPNAYQRAILEVGEVLQVYDSDKRFPAWGFGAR-PIDGPVSHCFNLNGSNSYCEVEGIPGIM  439 (561)
Q Consensus       361 SNg~~~~~~slh~~~~~~~~n~y~~ai~~i~~il~~yd~d~~~p~~GfG~~-~~~~~~~~~f~l~~~~~~~~~~g~~~v~  439 (561)
                      |||+|++++|||||+|. ++|+||+||++||++|++||+||+||+|||||+ |+++.+||||+||+++.+|+|.|++|||
T Consensus       297 SNg~p~~~sSLHyi~p~-~~N~Y~~Ai~~vG~~lq~ydsdk~fpa~GFGakip~~~~vs~~f~ln~~~~~~~c~Gi~gVl  375 (529)
T KOG1327|consen  297 SNGDPRNPSSLHYIDPH-QPNPYEQAIRSVGETLQDYDSDKLFPAFGFGAKIPPDGQVSHEFVLNFNPEDPECRGIEGVL  375 (529)
T ss_pred             cCCCCCCCCcceecCCC-CCCHHHHHHHHHhhhhcccCCCCccccccccccCCCCcccccceeecCCCCCCccccHHHHH
Confidence            99999999999999996 899999999999999999999999999999999 8899999999999999999999999999


Q ss_pred             HHHHhhhcceeecCCCCcHHHHHHHHHHHHhhccccCCceEEEEEEeCCcccCHHHHHHHHHHccCCCeEEEEEeecCCC
Q 008558          440 MAYTSALHNVNLAGPTLFGPVISNAALIAGQSLANHGQKYFVLLIITDGVVTDLQETKDALVKASDLPLSILIIGVGGAD  519 (561)
Q Consensus       440 ~~Y~~~~~~~~~~gpt~f~~ii~~~~~~a~~~~~~~~~~y~vlliltdg~i~d~~~t~~~i~~as~~p~siiivGvG~~~  519 (561)
                      +||++++++|+|+|||+|+|||++|+++|+++.+ ...+||||||||||+|+||++|++|||+||+|||||||||||++|
T Consensus       376 ~aY~~~lp~v~l~GPTnFaPII~~va~~a~~~~~-~~~qY~VLlIitDG~vTdm~~T~~AIV~AS~lPlSIIiVGVGd~d  454 (529)
T KOG1327|consen  376 EAYRKALPNVQLYGPTNFSPIINHVARIAQQSGN-TAGQYHVLLIITDGVVTDMKETRDAIVSASDLPLSIIIVGVGDAD  454 (529)
T ss_pred             HHHHhhcccccccCCCccHHHHHHHHHHHHHhcc-CCcceEEEEEEeCCccccHHHHHHHHHhhccCCeEEEEEEeCCCC
Confidence            9999999999999999999999999999999865 778999999999999999999999999999999999999999999


Q ss_pred             chhhhhcccCCCcccccCCCCccCCceeeeeecccccCC
Q 008558          520 FKEMEILDADKGERLESSTGRVASRDIVQFVPLKDVQSK  558 (561)
Q Consensus       520 f~~m~~ld~d~~~~l~~~~g~~~~rd~vqFv~~~~~~~~  558 (561)
                      |+.|++||+|. .+|+++ ||.+.|||||||+|+|+.++
T Consensus       455 f~~M~~lD~d~-~~l~~~-gr~~~rD~vQFV~f~~~~~~  491 (529)
T KOG1327|consen  455 FDMMRELDGDD-PKLRSP-GRIAERDNVQFVPFRDIMNG  491 (529)
T ss_pred             HHHHHHhhcCC-cccccc-cccccccceEeecHHHHhhc
Confidence            99999999888 677766 99999999999999999875

>cd01459 vWA_copine_like VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium Back     alignment and domain information
>PF07002 Copine: Copine; InterPro: IPR010734 This represents a conserved region approximately 180 residues long within eukaryotic copines Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>PF13768 VWA_3: von Willebrand factor type A domain Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK10997 yieM hypothetical protein; Provisional Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG4428 consensus Inositol-polyphosphate 4-phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF11775 CobT_C: Cobalamin biosynthesis protein CobT VWA domain Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 1e-16
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 5e-06
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 1e-13
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 3e-10
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 1e-08
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 7e-10
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 4e-05
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 1e-09
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 7e-09
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 1e-09
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 7e-09
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 2e-09
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 1e-08
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 2e-05
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 2e-08
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 4e-04
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 5e-08
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 1e-07
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 6e-08
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 9e-07
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 8e-07
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 1e-05
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 2e-06
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 3e-06
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 9e-06
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 3e-05
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 3e-05
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 2e-04
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 4e-05
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 4e-05
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 5e-05
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 5e-05
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 5e-05
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 9e-05
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 1e-04
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 7e-04
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 1e-04
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 6e-04
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 2e-04
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 3e-04
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 4e-04
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 9e-04
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
 Score = 79.5 bits (196), Expect = 1e-16
 Identities = 55/246 (22%), Positives = 94/246 (38%), Gaps = 42/246 (17%)

Query: 55  AADLRDRDVLSKSDPMLVVYMKAR---DGALVEVGRTEVVLNSLNPTWITKHIITYQFEV 111
           AA+L   D+   SDP    Y+K     D    +   T+V   +LNP +      T++   
Sbjct: 28  AAELPALDMGGTSDP----YVKVFLLPDKK--KKFETKVHRKTLNPVF--NEQFTFKVPY 79

Query: 112 VQ----TLVFRIYDVDTQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRR 167
            +    TLV  +YD D    +             +GE    ++ +          DL   
Sbjct: 80  SELAGKTLVMAVYDFDRFSKH-----------DIIGEFKVPMNTVDFGHVTEEWRDLQSA 128

Query: 168 EETITPITEESNPSNR-PKHCGKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFL 226
           E+       +   S R     GKLTV              IL   +L   D+   +DP++
Sbjct: 129 EKEEQEKLGDICFSLRYVPTAGKLTVV-------------ILEAKNLKKMDVGGLSDPYV 175

Query: 227 VISKIVESGTHIPVCKTEVLKNETKPTWKSVFL-NIQQVGSKDSPLIIECFNFNSNGKHD 285
            I  ++++G  +   KT + KN   P +   F   +     +   +++   +++  GK+D
Sbjct: 176 KIH-LMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKND 234

Query: 286 LIGKVQ 291
            IGKV 
Sbjct: 235 AIGKVF 240
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query561
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 100.0
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.97
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.75
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.73
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.72
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.71
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.7
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.7
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.7
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.68
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.68
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.68
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.68
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.68
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.67
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.67
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.67
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.67
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.66
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.66
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.66
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.66
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.65
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.65
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.65
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.65
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.65
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.65
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.65
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.65
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.65
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.64
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.64
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.64
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.64
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.64
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.64
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.64
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.64
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.63
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.63
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.63
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.63
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.62
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.62
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.62
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.61
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.61
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.61
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.61
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.61
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.61
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.6
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.6
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.6
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.6
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.6
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.6
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.59
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.59
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.58
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.57
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.56
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.55
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.55
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.54
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.52
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.52
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.51
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.51
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.5
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.46
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.33
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.31
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.3
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.29
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.26
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.22
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.2
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.19
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.13
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.1
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.09
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.06
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.06
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.03
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 98.83
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.82
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.79
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 98.78
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.76
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.47
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.41
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.29
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.28
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.27
4hqf_A281 Thrombospondin-related anonymous protein, trap; ma 97.91
4hqo_A266 Sporozoite surface protein 2; malaria, gliding mot 97.89
3n2n_F185 Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho 97.8
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hy 97.76
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold 97.76
3ibs_A218 Conserved hypothetical protein BATB; structural ge 97.71
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 97.71
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell a 97.7
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, 97.61
2b2x_A223 Integrin alpha-1; computational design, antibody-a 97.61
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, 97.58
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; 97.54
4fx5_A 464 VON willebrand factor type A; structural genomics, 97.54
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, anta 97.41
1pt6_A213 Integrin alpha-1; cell adhesion; 1.87A {Homo sapie 97.4
1atz_A189 VON willebrand factor; collagen-binding, hemostasi 97.32
2odp_A 509 Complement C2; C3/C5 convertase, complement serin 97.19
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 97.1
4b4t_W268 RPN10, 26S proteasome regulatory subunit RPN10; hy 97.05
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 96.95
3zqk_A199 VON willebrand factor; blood clotting, adamts-13, 96.85
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 96.84
3hrz_D 741 Complement factor B; serine protease, glycosilated 96.71
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 96.67
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1. 96.62
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule 96.59
1jey_A 609 KU70; double-strand DNA break repair, non-homologo 95.01
1jey_B 565 KU80; double-strand DNA break repair, non-homologo 94.71
1yvr_A538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 93.36
2nvo_A535 RO sixty-related protein, RSR; alpha helical repea 91.68
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=100.00  E-value=1.1e-31  Score=271.86  Aligned_cols=222  Identities=21%  Similarity=0.319  Sum_probs=185.4

Q ss_pred             cEEEEE-EEEcCCCCCCCCCCCCcEEEEEEEcCCCceeeEeeeeeecCCCCCceeeeEEEEEeeCc--eeEEEEEEEEcc
Q 008558           47 SQIELS-FSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEV--VQTLVFRIYDVD  123 (561)
Q Consensus        47 ~~vel~-isa~~L~~~D~~sksDPyv~v~~~~~~~~~~~~~rTevi~n~lNP~w~e~f~i~~~fe~--~q~L~~~VyD~D  123 (561)
                      ..+.++ ++|++|+.+|..+++||||+|++.+...   ...||+++++|+||.|+|+|.|.+.+++  .+.|+|+|||.|
T Consensus        19 ~~L~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~---~~~~T~~~~~~~nP~wne~f~f~v~~~~~~~~~l~~~V~d~d   95 (284)
T 2r83_A           19 NQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKK---KKFETKVHRKTLNPVFNEQFTFKVPYSELAGKTLVMAVYDFD   95 (284)
T ss_dssp             TEEEEEEEEEECCCCCSSSSSCCEEEEEEEETCTT---SCEECCCCCSCSSCEEEEEEEECCCGGGCTTCEEEEEEEECC
T ss_pred             CEEEEEEEEeeCCCCCCCCCCCCeEEEEEEEcCCC---ceEeCCcccCCCCCeeCceEEEEechHHhCcCEEEEEEEECC
Confidence            556666 6899999999999999999999986333   4789999999999999999999877654  369999999999


Q ss_pred             CCcccccccccccccceeeeeeEeechhhhccCCeeEEEEccccccccccccccCCCCCCCcccceEEeecceecccccc
Q 008558          124 TQFHNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESNPSNRPKHCGKLTVHAEECINSKTT  203 (561)
Q Consensus       124 ~~~~~~~~~~~~l~~~d~LG~~~~~L~el~~~~~~~~~~~L~~~~~~i~~~~~~~~~~~~~~~~G~I~i~~e~i~~~~~~  203 (561)
                      ..           +++++||++.++|.++........|++|...          ...  .....|.|.+.+.+.+....+
T Consensus        96 ~~-----------~~~~~lG~~~i~l~~l~~~~~~~~w~~L~~~----------~~~--~~~~~G~i~l~l~~~p~~~~l  152 (284)
T 2r83_A           96 RF-----------SKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA----------EKE--EQEKLGDICFSLRYVPTAGKL  152 (284)
T ss_dssp             SS-----------SCCCEEEEEEEEGGGCCCSSCEEEEEECBCC----------SSC--CCCCCCEEEEEEEEETTTTEE
T ss_pred             CC-----------CCCceeEEEEEcchhcccCCcceeEEEeecc----------ccc--cccccccEEEEEEecCcCCce
Confidence            65           6899999999999999877777789999651          110  124579999999988888888


Q ss_pred             ceeEeeecCCCcCCCCCCCCceEEEEEEcCCCceeeEEEceeecCCCCCceec-ceeeeeecCC-CCccEEEEEEeccCC
Q 008558          204 TELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLKNETKPTWKS-VFLNIQQVGS-KDSPLIIECFNFNSN  281 (561)
Q Consensus       204 v~~~i~a~nL~~~d~~g~sDPy~~i~~~~~~g~~~~~~kTevik~tlnP~W~e-f~~~~~~l~d-~~~~L~ieV~D~d~~  281 (561)
                      .+.+++|++|+.+|.+|.+|||+++++..+ +.....+||+++++++||+|++ |.+.+.. .+ ....|.|+|||++..
T Consensus       153 ~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~-~~~~~~~kT~v~~~t~nP~wne~f~f~v~~-~~l~~~~l~i~V~d~d~~  230 (284)
T 2r83_A          153 TVVILEAKNLKKMDVGGLSDPYVKIHLMQN-GKRLKKKKTTIKKNTLNPYYNESFSFEVPF-EQIQKVQVVVTVLDYDKI  230 (284)
T ss_dssp             EEEEEEEESCCCCSTTSCCCEEEEEEEEET-TEEEEEEECCCCCSCSSCEEEEEEEEECCT-TTGGGEEEEEEEEECCSS
T ss_pred             EEEEEEeECCCCcCCCCCcCeEEEEEEEeC-CcEeeeeccceecCCCCCEEceeEEEeCCH-HHhCceEEEEEEEeCCCC
Confidence            889999999999999999999999998763 5556789999999999999998 5554421 11 135799999999999


Q ss_pred             CCCceeEEEEEehhh
Q 008558          282 GKHDLIGKVQKSLAD  296 (561)
Q Consensus       282 g~~d~IG~~~i~l~~  296 (561)
                      +++++||++.+++..
T Consensus       231 ~~~~~iG~~~i~l~~  245 (284)
T 2r83_A          231 GKNDAIGKVFVGYNS  245 (284)
T ss_dssp             SCCCEEEEEEEETTC
T ss_pred             CCCcEEEEEEECCCC
Confidence            999999999999975
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A Back     alignment and structure
>4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* Back     alignment and structure
>3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B Back     alignment and structure
>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* Back     alignment and structure
>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 561
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 5e-11
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 7e-05
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-09
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-05
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 3e-08
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 5e-05
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 5e-08
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 6e-08
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 3e-04
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 1e-07
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 1e-07
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 2e-06
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-07
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 2e-06
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 6e-06
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 7e-06
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 2e-05
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 0.001
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 4e-05
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 0.002
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 0.003
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain from protein kinase c (beta)
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 58.2 bits (140), Expect = 5e-11
 Identities = 23/112 (20%), Positives = 51/112 (45%), Gaps = 3/112 (2%)

Query: 188 GKLTVHAEECINSKTTTELILRCSDLDCKDLFSRNDPFLVISKIVESGTHIPVCKTEVLK 247
           G++ + A   I+ +    ++    +L   D    +DP+ V  K++         KT+ +K
Sbjct: 4   GRIYIQAH--IDREVLIVVVRDAKNLVPMDPNGLSDPY-VKLKLIPDPKSESKQKTKTIK 60

Query: 248 NETKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKVQKSLADLEK 299
               P W   F    +   KD  L +E ++++   ++D +G +   +++L+K
Sbjct: 61  CSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQK 112
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query561
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.72
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.69
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.68
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.67
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.66
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.65
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.64
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.63
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.6
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.6
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.59
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.58
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.57
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.56
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.55
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.55
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.55
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.55
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.53
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.53
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.53
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.52
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.52
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.49
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.48
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.47
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.46
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.46
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.45
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.45
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.43
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.42
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.39
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.38
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.31
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.24
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.17
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.08
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 98.97
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.85
d1shux_181 Capillary morphogenesis protein 2 domain {Human (H 97.93
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo 97.29
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub 97.29
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId 97.15
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId 97.11
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI 97.04
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapien 96.96
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo 96.84
d1q0pa_209 Complement factor B domain {Human (Homo sapiens) [ 96.69
d1jeyb2236 Ku80 subunit N-terminal domain {Human (Homo sapien 96.57
d1mjna_179 Integrin CD11a/CD18 (Leukocyte function associated 95.92
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c 95.21
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.72  E-value=2.2e-17  Score=144.45  Aligned_cols=117  Identities=21%  Similarity=0.311  Sum_probs=94.5

Q ss_pred             EEEEE-EEEcCCCCCCCCCCCCcEEEEEEEcCCCceeeEeeeeeecCCCCCceeeeEEEEEeeCceeEEEEEEEEccCCc
Q 008558           48 QIELS-FSAADLRDRDVLSKSDPMLVVYMKARDGALVEVGRTEVVLNSLNPTWITKHIITYQFEVVQTLVFRIYDVDTQF  126 (561)
Q Consensus        48 ~vel~-isa~~L~~~D~~sksDPyv~v~~~~~~~~~~~~~rTevi~n~lNP~w~e~f~i~~~fe~~q~L~~~VyD~D~~~  126 (561)
                      .++++ ++|++|+.+|..|++||||++++.+      ...||+++++++||.|+|.|.|.... ..+.|.|+|||+|.. 
T Consensus         7 ~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~------~~~~T~~~~~t~nP~wne~f~f~v~~-~~~~L~i~V~d~~~~-   78 (126)
T d2ep6a1           7 ILQVKVLKAADLLAADFSGKSDPFCLLELGN------DRLQTHTVYKNLNPEWNKVFTFPIKD-IHDVLEVTVFDEDGD-   78 (126)
T ss_dssp             EEEEEEEEEESCCCSSSSSCCCEEEEEEETT------EEEECCCCSSCSSCCCCEEEEEEESC-TTCEEEEEEEEEETT-
T ss_pred             EEEEEEEEeECCCCCCCCCCcCeEEEEEcCC------eEEEEEeeCCceeEEEEEEEEEEEec-cCceeEEEEEEccCC-
Confidence            45665 6999999999999999999999954      57899999999999999999988654 346899999999875 


Q ss_pred             ccccccccccccceeeeeeEeechhhhccCCeeEEEEccccccccccccccCCCCCCCcccceEEeeccee
Q 008558          127 HNVDVKTLKLVEQQFLGEATCTLSQIVTRKNRSLTLDLVRREETITPITEESNPSNRPKHCGKLTVHAEEC  197 (561)
Q Consensus       127 ~~~~~~~~~l~~~d~LG~~~~~L~el~~~~~~~~~~~L~~~~~~i~~~~~~~~~~~~~~~~G~I~i~~e~i  197 (561)
                                +++++||++.++|.++...  ...|+.|..           ...  ....+|+|+++.+.+
T Consensus        79 ----------~~d~~lG~~~i~l~~l~~~--~~~~~~l~~-----------~~~--~~~~~G~i~l~~~~i  124 (126)
T d2ep6a1          79 ----------KPPDFLGKVAIPLLSIRDG--QPNCYVLKN-----------KDL--EQAFKGVIYLEMDLI  124 (126)
T ss_dssp             ----------EEEEECCBCEEEGGGCCSS--CCEECCCBC-----------SCT--TSCCSSEEEEEEEEE
T ss_pred             ----------cCcceEEEEEEEHHHCCCC--CceEEEccc-----------cCC--CCceeEEEEEEEEEE
Confidence                      6789999999999998654  346777754           221  224569999887654
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure