Citrus Sinensis ID: 008575


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-
MGNDGDPKKRKSKSPKTPNESALKQKSPAEFFAENKNIAGFDNPGKSLYTTVRELVENSLDSAESISELPVVEITIEEIGKSKFNSMIGLVDRERVDTKLYDDYETEKARERRLAKEARAQELQAKNAALGKKVKEPSATKGAKGRGEASFYRVTCKDNGKGMPHDDIPNMFGRVLSGTKYGLKQTRGKFGLGAKMALIWSKMSTGLPIEISSSMRSHNFISFCKLDIDIHRNIPHVHLHEKRENKDRWHGAEIQVVIEGNWTTYRSKILHYMRQMAVITPYAQFLFKFVSEVAEKNVTIRFSRRTDVMPPVPVETKHHPSSVDLLLIKGLIAETSKGTLLQFLQHEFVNIGKSLAERLIGEMGPEFSPKMAVKSLTSQQIVRIHQLFRQAKFDDPSGGCLSPAGEYNLRLGIIKELHPDMVATYSGSAQVFEGHPFIVEAGVSVGGKDVKQGLNIFRFANRIPLLFEQGGDVVTRTAMKRINWSSYKINQTQDKIGVFVSIVSTKIPFKGTGKEYIGDDTKEIASAVKSAIQQCCIQLKSKIVRKIQDREQQERKRNLSR
cccccccccccccccccccHHHHccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEECcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEECccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEECcccccEEEEEEEEEEccccccEEEEcEEEcccccccCEEEEEEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEcccccccccEEEEccccccccccccccccccccccHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccEEEEECccccECccccEEEEEEEEEcccccccccEEEEEEccccccccccccEEHHHHHccccccccccccccccEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*****************************EFFAENKNIAGFDNPGKSLYTTVRELVENSLDSAESISELPVVEITIEEIGKSKFNSMIGLVDRERVDTKLYDDYETEK*****************************************SFYRVTCKDNGKGMPHDDIPNMFGRVLSGTKYGLKQTRGKFGLGAKMALIWSKMSTGLPIEISSSMRSHNFISFCKLDIDIHRNIPHVHLHEKRENKDRWHGAEIQVVIEGNWTTYRSKILHYMRQMAVITPYAQFLFKFVSEVAEKNVTIRFSRRTDVMPPVPVETKHHPSSVDLLLIKGLIAETSKGTLLQFLQHEFVNIGKSLAERLIGEMGPEFSPKMAVKSLTSQQIVRIHQLFRQAKFDDPSGGCLSPAGEYNLRLGIIKELHPDMVATYSGSAQVFEGHPFIVEAGVSVGGKDVKQGLNIFRFANRIPLLFEQGGDVVTRTAMKRINWSSYKINQTQDKIGVFVSIVSTKIPFKGTGKEYIGDDTKEIASAVKSAIQQCCIQLKSKIVR****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNDGDPKKRKSKSPKTPNESALKQKSPAEFFAENKNIAGFDNPGKSLYTTVRELVENSLDSAESISELPVVEITIEEIGKSKFNSMIGLVDRERVDTKLxxxxxxxxxxxxxxxxxxxxxxxxxxNAALGKKVKEPSATKGAKGRGEASFYRVTCKDNGKGMPHDDIPNMFGRVLSGTKYGLKQTRGKFGLGAKMALIWSKMSTGLPIEISSSMRSHNFISFCKLDIDIHRNIPHVHLHEKRENKDRWHGAEIQVVIEGNWTTYRSKILHYMRQMAVITPYAQFLFKFVSEVAEKNVTIRFSRRTDVMPPVPVETKHHPSSVDLLLIKGLIAETSKGTLLQFLQHEFVNIGKSLAERLIGEMGPEFSPKMAVKSLTSQQIVRIHQLFRQAKFDDPSGGCLSPAGEYNLRLGIIKELHPDMVATYSGSAQVFEGHPFIVEAGVSVGGKDVKQGLNIFRFANRIPLLFEQGGDVVTRTAMKRINWSSYKINQTQDKIGVFVSIVSTKIPFKGTGKEYIGDDTKEIASAVKSAIQQCCIQLKSKIVRKIQDREQQERKRNLSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA topoisomerase 6 subunit B Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles. Relaxes both positive and negative superturns and exhibits a strong decatenase activity. The B subunit binds ATP. Involved in cell-elongation processes.confidentQ9C5V6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.99.-.-Other isomerases.probable
5.99.1.-Sole sub-subclass for isomerases that do not belong in the other subclasses.probable
5.99.1.3DNA topoisomerase (ATP-hydrolyzing).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZBK, chain B
Confidence level:very confident
Coverage over the Query: 30-81,148-561
View the alignment between query and template
View the model in PyMOL