Citrus Sinensis ID: 008580
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 561 | ||||||
| 255559909 | 561 | histone acetyltransferase gcn5, putative | 0.980 | 0.980 | 0.835 | 0.0 | |
| 224082720 | 564 | histone acetyltransferase [Populus trich | 0.978 | 0.973 | 0.825 | 0.0 | |
| 449433487 | 561 | PREDICTED: histone acetyltransferase GCN | 0.976 | 0.976 | 0.788 | 0.0 | |
| 356503570 | 543 | PREDICTED: histone acetyltransferase GCN | 0.909 | 0.939 | 0.806 | 0.0 | |
| 356570608 | 540 | PREDICTED: histone acetyltransferase GCN | 0.907 | 0.942 | 0.804 | 0.0 | |
| 18410098 | 568 | histone acetyltransferase GCN5 [Arabidop | 0.991 | 0.978 | 0.743 | 0.0 | |
| 297816758 | 568 | hypothetical protein ARALYDRAFT_485863 [ | 0.991 | 0.978 | 0.740 | 0.0 | |
| 359479577 | 541 | PREDICTED: histone acetyltransferase GCN | 0.957 | 0.992 | 0.743 | 0.0 | |
| 7258364 | 586 | histon acetyltransferase HAT1 [Arabidops | 0.991 | 0.948 | 0.720 | 0.0 | |
| 297735483 | 416 | unnamed protein product [Vitis vinifera] | 0.668 | 0.901 | 0.781 | 0.0 |
| >gi|255559909|ref|XP_002520973.1| histone acetyltransferase gcn5, putative [Ricinus communis] gi|223539810|gb|EEF41390.1| histone acetyltransferase gcn5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 884 bits (2283), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 478/572 (83%), Positives = 505/572 (88%), Gaps = 22/572 (3%)
Query: 1 MDTHAHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPP 60
MDTH+HS HL NRSRSSQ+PSPSHSASASATSSIHKRKLAA A+A ASEDHAP P
Sbjct: 1 MDTHSHS-HLNVTNRSRSSQSPSPSHSASASATSSIHKRKLAAAASA-ASEDHAPPFPPS 58
Query: 61 SFSADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEFENDNDSSMRTFTAARL 120
SFSADTRDGALTSNDDLESISARGADSD+D + V DD+++ E DNDSSMRTF AARL
Sbjct: 59 SFSADTRDGALTSNDDLESISARGADSDSDADDSDAVVDDDED-EFDNDSSMRTFNAARL 117
Query: 121 ENNNSVGSA-----------RNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSS 169
E N + RNTK+KTENSTVKIE DGGK+G G+G +GS AGSS
Sbjct: 118 ETNAGASAPGGGSGGGGSSARNTKIKTENSTVKIEKLDGGKDG---GTGAMGSIT-AGSS 173
Query: 170 VLGTAGKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGL 229
+L KED VKIFTEN+Q SGAYSAREE LKREEEAG LKFVCLSNDGID HMVWLIGL
Sbjct: 174 ILA---KEDAVKIFTENLQTSGAYSAREESLKREEEAGRLKFVCLSNDGIDAHMVWLIGL 230
Query: 230 KNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITA 289
KNIFARQLPNMPKEYIVRLVMDRSHKSVMVIR N VVGGITYRPYVSQKFGEIAFCAITA
Sbjct: 231 KNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRRNHVVGGITYRPYVSQKFGEIAFCAITA 290
Query: 290 DEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYI 349
DEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYI
Sbjct: 291 DEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYI 350
Query: 350 KDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVP 409
KDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVY GIDFQKKEAG+P
Sbjct: 351 KDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYQGIDFQKKEAGIP 410
Query: 410 KKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDA 469
KKI+KVEDIPGLREAGWTPDQWGHSRF T +TD A+NQKH TAFMRSLLKSMHDHVDA
Sbjct: 411 KKIVKVEDIPGLREAGWTPDQWGHSRFNTFNTSTDTATNQKHWTAFMRSLLKSMHDHVDA 470
Query: 470 WPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNS 529
WPFKEPVD RDVPDYY+IIKDP+DL+TMSKR+ESEQYYVTF+MFVADVKRMFANARTYNS
Sbjct: 471 WPFKEPVDGRDVPDYYDIIKDPIDLKTMSKRIESEQYYVTFDMFVADVKRMFANARTYNS 530
Query: 530 PDTIYYKCATRLESHFQSKVQSGLHSSTKIQQ 561
PDTIYYKCATRLE+HF+SKVQSG S+ KIQQ
Sbjct: 531 PDTIYYKCATRLEAHFESKVQSGFQSA-KIQQ 561
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224082720|ref|XP_002306812.1| histone acetyltransferase [Populus trichocarpa] gi|222856261|gb|EEE93808.1| histone acetyltransferase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449433487|ref|XP_004134529.1| PREDICTED: histone acetyltransferase GCN5-like [Cucumis sativus] gi|449490675|ref|XP_004158674.1| PREDICTED: histone acetyltransferase GCN5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356503570|ref|XP_003520580.1| PREDICTED: histone acetyltransferase GCN5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356570608|ref|XP_003553477.1| PREDICTED: histone acetyltransferase GCN5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18410098|ref|NP_567002.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|75167544|sp|Q9AR19.1|GCN5_ARATH RecName: Full=Histone acetyltransferase GCN5; Short=AtGCN5; AltName: Full=BIG TOP protein gi|13591696|gb|AAK31318.1|AF338768_1 histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|13591702|gb|AAK31321.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|25083382|gb|AAN72068.1| Expressed protein [Arabidopsis thaliana] gi|31711984|gb|AAP68348.1| At3g54610 [Arabidopsis thaliana] gi|332645734|gb|AEE79255.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297816758|ref|XP_002876262.1| hypothetical protein ARALYDRAFT_485863 [Arabidopsis lyrata subsp. lyrata] gi|297322100|gb|EFH52521.1| hypothetical protein ARALYDRAFT_485863 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|359479577|ref|XP_002275146.2| PREDICTED: histone acetyltransferase GCN5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|7258364|emb|CAB77581.1| histon acetyltransferase HAT1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297735483|emb|CBI17923.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 561 | ||||||
| TAIR|locus:3354973 | 568 | HAG1 "histone acetyltransferas | 0.991 | 0.978 | 0.655 | 5.3e-198 | |
| SGD|S000003484 | 439 | GCN5 "Acetyltransferase, modif | 0.590 | 0.753 | 0.489 | 1.2e-85 | |
| POMBASE|SPAC1952.05 | 454 | gcn5 "SAGA complex histone ace | 0.595 | 0.735 | 0.465 | 3.2e-81 | |
| UNIPROTKB|F1MRA1 | 836 | F1MRA1 "Uncharacterized protei | 0.563 | 0.377 | 0.474 | 8.5e-81 | |
| UNIPROTKB|E1BP59 | 823 | KAT2A "Uncharacterized protein | 0.559 | 0.381 | 0.478 | 2.2e-80 | |
| UNIPROTKB|E2RGW1 | 837 | KAT2A "Uncharacterized protein | 0.559 | 0.375 | 0.478 | 2.2e-80 | |
| UNIPROTKB|Q92830 | 837 | KAT2A "Histone acetyltransfera | 0.559 | 0.375 | 0.478 | 2.2e-80 | |
| UNIPROTKB|F1S0Q0 | 837 | KAT2A "Uncharacterized protein | 0.559 | 0.375 | 0.478 | 2.2e-80 | |
| MGI|MGI:1343101 | 830 | Kat2a "K(lysine) acetyltransfe | 0.559 | 0.378 | 0.478 | 2.2e-80 | |
| RGD|1307242 | 833 | Kat2a "K(lysine) acetyltransfe | 0.559 | 0.376 | 0.478 | 2.2e-80 |
| TAIR|locus:3354973 HAG1 "histone acetyltransferase of the GNAT family 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1917 (679.9 bits), Expect = 5.3e-198, P = 5.3e-198
Identities = 371/566 (65%), Positives = 422/566 (74%)
Query: 5 AHSAHLTAPNXXXXXXXXXXXXXXXXXXXXXIHKRKLXXXXXX--XXSEDHAP--HAFPP 60
+HS+HL A N +HKRKL SEDHAP +FPP
Sbjct: 3 SHSSHLNAANRSRSSQTPSPSHSASASVTSSLHKRKLAATTAANAAASEDHAPPSSSFPP 62
Query: 61 S-FSADTRDGALTSNDDLESISARGAXXXXXXXXXXXXXXXXXXXXXX----XXXXMRTF 115
S FSADTRDGALTSND+LESISARGA +RTF
Sbjct: 63 SSFSADTRDGALTSNDELESISARGADTDSDPDESEDIVVDDDEDEFAPEQDQDSSIRTF 122
Query: 116 TAARLENNNSV-GSARNTKLKTENSTVKIENSDGGKEXXXXXXXXXXXXXXXXXXVLGTA 174
TAARL++++ V GS+RNTKLKTE+STVK+E+SDGGK+ + G
Sbjct: 123 TAARLDSSSGVNGSSRNTKLKTESSTVKLESSDGGKDGGSSVVGTGVSGTVGGSSISGLV 182
Query: 175 GKEDTVKIFTENIQASGAYSXXXXXXXXXXXXGNLKFVCLSNDGIDEHMVWLIGLKNIFA 234
K+++VK+ EN Q SGAY G LKFVC SND IDEHM+ LIGLKNIFA
Sbjct: 183 PKDESVKVLAENFQTSGAYIAREEALKREEQAGRLKFVCYSNDSIDEHMMCLIGLKNIFA 242
Query: 235 RQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVK 294
RQLPNMPKEYIVRL+MDR HKSVMV+RGN+VVGGITYRPY SQKFGEIAFCAITADEQVK
Sbjct: 243 RQLPNMPKEYIVRLLMDRKHKSVMVLRGNLVVGGITYRPYHSQKFGEIAFCAITADEQVK 302
Query: 295 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDG 354
GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYF+KQGFTKEIYLEKD W G+IKDYDG
Sbjct: 303 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDYDG 362
Query: 355 GILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIK 414
G+LMECKIDPKLPYTDLS+MIR+QR+AIDE+IRELSNC VYP I+F K EAG+P+KIIK
Sbjct: 363 GLLMECKIDPKLPYTDLSSMIRQQRKAIDERIRELSNCQNVYPKIEFLKNEAGIPRKIIK 422
Query: 415 VEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKE 474
VE+I GLREAGWTPDQWGH+RF+ + D +NQK L A MR+LLK+M DH DAWPFKE
Sbjct: 423 VEEIRGLREAGWTPDQWGHTRFKLFNGSADMVTNQKQLNALMRALLKTMQDHADAWPFKE 482
Query: 475 PVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIY 534
PVD+RDVPDYY+IIKDP+DL+ ++KRVESEQYYVT +MFVAD +RMF N RTYNSPDTIY
Sbjct: 483 PVDSRDVPDYYDIIKDPIDLKVIAKRVESEQYYVTLDMFVADARRMFNNCRTYNSPDTIY 542
Query: 535 YKCATRLESHFQSKVQSGLHSSTKIQ 560
YKCATRLE+HF SKVQ+GL S K Q
Sbjct: 543 YKCATRLETHFHSKVQAGLQSGAKSQ 568
|
|
| SGD|S000003484 GCN5 "Acetyltransferase, modifies N-terminal lysines on histones H2B and H3" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1952.05 gcn5 "SAGA complex histone acetyltransferase catalytic subunit Gcn5" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MRA1 F1MRA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BP59 KAT2A "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGW1 KAT2A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92830 KAT2A "Histone acetyltransferase KAT2A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S0Q0 KAT2A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1343101 Kat2a "K(lysine) acetyltransferase 2A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307242 Kat2a "K(lysine) acetyltransferase 2A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 561 | |||
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 2e-50 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 1e-38 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 1e-36 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 9e-33 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 4e-23 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 6e-23 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 3e-22 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 4e-22 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 4e-22 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 2e-21 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 6e-21 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 6e-21 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 1e-20 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 2e-20 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 4e-20 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 7e-20 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 2e-17 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 2e-16 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 9e-16 | |
| cd05496 | 119 | cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I | 5e-15 | |
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 9e-15 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 3e-14 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 3e-14 | |
| cd05529 | 128 | cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe | 4e-14 | |
| cd05520 | 103 | cd05520, Bromo_polybromo_III, Bromodomain, polybro | 4e-14 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 1e-13 | |
| cd05507 | 104 | cd05507, Bromo_brd8_like, Bromodomain, brd8_like s | 3e-13 | |
| cd05516 | 107 | cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su | 2e-12 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 1e-11 | |
| cd05521 | 106 | cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in | 7e-11 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 2e-10 | |
| cd05517 | 103 | cd05517, Bromo_polybromo_II, Bromodomain, polybrom | 4e-10 | |
| pfam00583 | 80 | pfam00583, Acetyltransf_1, Acetyltransferase (GNAT | 4e-10 | |
| cd05525 | 106 | cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa | 5e-09 | |
| cd05494 | 114 | cd05494, Bromodomain_1, Bromodomain; uncharacteriz | 5e-09 | |
| pfam13508 | 79 | pfam13508, Acetyltransf_7, Acetyltransferase (GNAT | 9e-08 | |
| cd05508 | 99 | cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf | 1e-07 | |
| cd04301 | 65 | cd04301, NAT_SF, N-Acyltransferase superfamily: Va | 9e-06 | |
| COG1246 | 153 | COG1246, ArgA, N-acetylglutamate synthase and rela | 1e-05 | |
| cd05501 | 102 | cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li | 4e-05 | |
| TIGR01890 | 429 | TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran | 7e-04 | |
| pfam13673 | 118 | pfam13673, Acetyltransf_10, Acetyltransferase (GNA | 0.001 |
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
Score = 168 bits (428), Expect = 2e-50
Identities = 52/99 (52%), Positives = 69/99 (69%), Gaps = 1/99 (1%)
Query: 452 LTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFE 511
L ++ +L S+ +H AWPF EPVD + PDYY++IK PMDL TM +++E+ YYVT E
Sbjct: 2 LYTQLKKVLDSLKNHKSAWPFLEPVDKEEAPDYYDVIKKPMDLSTMEEKLENG-YYVTLE 60
Query: 512 MFVADVKRMFANARTYNSPDTIYYKCATRLESHFQSKVQ 550
FVAD+K +F N R YN PDT YYKCA +LE F K++
Sbjct: 61 EFVADLKLIFDNCRLYNGPDTEYYKCANKLEKFFWKKLK 99
|
Gcn5p is a histone acetyltransferase (HAT) which mediates acetylation of histones at lysine residues; such acetylation is generally correlated with the activation of transcription. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 101 |
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >gnl|CDD|224167 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|222309 pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 561 | |||
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 100.0 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.94 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.94 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.94 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.94 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.93 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.93 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.93 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.92 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.92 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.92 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.92 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.91 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.91 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.91 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.91 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.91 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.91 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.91 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.91 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.91 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.91 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 99.9 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.9 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.89 | |
| smart00297 | 107 | BROMO bromo domain. | 99.89 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.89 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.89 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.88 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.88 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.88 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.88 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.88 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.85 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.85 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.84 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.83 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.82 | |
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.72 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 99.7 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 99.43 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 99.32 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 99.25 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 99.23 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 99.22 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 99.19 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 99.17 | |
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 99.16 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 99.14 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 99.13 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 99.12 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 99.12 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 99.11 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 99.08 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 99.07 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 99.06 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 99.05 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 99.03 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 98.99 | |
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 98.98 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 98.98 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 98.98 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 98.98 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 98.97 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 98.95 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 98.95 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 98.94 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 98.92 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 98.9 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 98.89 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 98.88 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 98.84 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 98.83 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 98.82 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 98.81 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 98.77 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 98.77 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 98.76 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 98.76 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 98.75 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 98.75 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 98.71 | |
| PHA01807 | 153 | hypothetical protein | 98.7 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 98.68 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 98.67 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 98.66 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.63 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 98.57 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 98.56 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 98.54 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 98.5 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.48 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 98.48 | |
| KOG3396 | 150 | consensus Glucosamine-phosphate N-acetyltransferas | 98.46 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 98.43 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 98.38 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 98.33 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 98.32 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 98.27 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 98.25 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 98.24 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 98.23 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 98.2 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 98.17 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 98.11 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 98.04 | |
| KOG1828 | 418 | consensus IRF-2-binding protein CELTIX-1, contains | 97.97 | |
| KOG1828 | 418 | consensus IRF-2-binding protein CELTIX-1, contains | 97.96 | |
| KOG3397 | 225 | consensus Acetyltransferases [General function pre | 97.86 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 97.71 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 97.55 | |
| KOG3234 | 173 | consensus Acetyltransferase, (GNAT) family [Genera | 97.51 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 97.46 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 97.44 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 97.33 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 97.26 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 97.22 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 97.15 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 97.15 | |
| KOG3235 | 193 | consensus Subunit of the major N alpha-acetyltrans | 97.07 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 96.98 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 95.99 | |
| KOG4135 | 185 | consensus Predicted phosphoglucosamine acetyltrans | 95.89 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 95.86 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 95.58 | |
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 95.11 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 95.04 | |
| KOG4144 | 190 | consensus Arylalkylamine N-acetyltransferase [Gene | 94.44 | |
| PF00765 | 182 | Autoind_synth: Autoinducer synthetase; InterPro: I | 94.44 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 93.85 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 93.49 | |
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 91.97 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 91.24 | |
| cd04265 | 99 | DUF619-NAGS-U DUF619 domain of various N-acetylglu | 90.26 | |
| COG5628 | 143 | Predicted acetyltransferase [General function pred | 90.15 | |
| TIGR03019 | 330 | pepcterm_femAB FemAB-related protein, PEP-CTERM sy | 89.6 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 89.41 | |
| KOG2535 | 554 | consensus RNA polymerase II elongator complex, sub | 89.02 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 87.47 | |
| PF13880 | 70 | Acetyltransf_13: ESCO1/2 acetyl-transferase | 86.7 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 86.13 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 84.16 | |
| KOG2036 | 1011 | consensus Predicted P-loop ATPase fused to an acet | 80.4 |
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-67 Score=584.04 Aligned_cols=348 Identities=47% Similarity=0.826 Sum_probs=324.6
Q ss_pred chhhHHHHHHHHcCceEEEEEeCCCh----hhHHHHHHHHHHHHhhhCCCCcHHHHHhhhhcCCCcEEEEEECCe-EEEE
Q 008580 194 SAREELLKREEEAGNLKFVCLSNDGI----DEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNV-VVGG 268 (561)
Q Consensus 194 ~~r~~~~~~ee~~g~i~f~vv~nd~~----~~~~~~L~~lkniF~~qLP~MpkeYI~Rlv~D~~h~slvl~~~g~-VIGG 268 (561)
..|++.+..||..|.|.|+||.|+.+ ...++||++++|+|++|||+||++||.|||||..|++++++++++ ||||
T Consensus 355 ~~n~~~~n~ee~~~~~~~~vv~~~~s~~~~~~~~~~li~~~~~f~~qL~empkEyi~rlv~d~~h~~~~~~~d~~g~vgg 434 (720)
T KOG1472|consen 355 WRNCEKYNSEESHGLIEFAVIMNSKSLALIKEIPIELIGLRNEFSKQLPEMPKEYISRLVFDTSHHVMARIKDNEGVVGG 434 (720)
T ss_pred HhcchhhccccchhhhhhhhhhccCcHhHhccchhhhccchhHHHhhcccchHHHHHhhccccccccceeeccccccccc
Confidence 45899999999999999999999988 788999999999999999999999999999999999999999876 9999
Q ss_pred EEEeeecCCceEEEEEEEeccCCcccChHHHHHHHHHHHHHhhcCceEEEEccCCcchhhhhhcCCccccccccceeeee
Q 008580 269 ITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGY 348 (561)
Q Consensus 269 I~~R~f~~~~f~EI~f~AV~~~~QgKGyGt~Lmn~Lke~ak~~~gi~~~lt~AD~~AigFYkKqGFsk~i~l~~~~w~G~ 348 (561)
||+|+|+.++|.||+||||+.+.|++|||++||+|+++|.+....+.+++||||+.|++||+||||+++|.+++.+|.||
T Consensus 435 i~~r~f~~k~f~eivf~av~~~eqv~g~g~hlmnhlkd~~~~~~~i~~~ltyad~~aigyfkkqgfs~ei~~~~~~~~g~ 514 (720)
T KOG1472|consen 435 ICFRPFPEKGFTEIVFCAVTTDEQVKGSGTHLMNHLKDYVRSSSTIDYALTYADEGAIGYFKKQGFSKEIKFEKSPYVGY 514 (720)
T ss_pred cccCcCcccCCcceeeccccCcccccccCcCchhhHHHHhhccchHHHHHHhhhhcccccccCccchhhcccccCcCccc
Confidence 99999999999999999999999999999999999999999843499999999999999999999999999999999999
Q ss_pred eecCCCceeEeeeeCCCCCccchhHHHH-HHHHHHHHHHH-HhhccccccCCCcccccccCCCccccCCCCCCcccccCC
Q 008580 349 IKDYDGGILMECKIDPKLPYTDLSTMIR-RQRQAIDEKIR-ELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGW 426 (561)
Q Consensus 349 IKdYegatLM~C~l~p~i~Y~~~~~~i~-~Qk~~i~~~i~-~~s~~~iVypGL~~~k~e~g~p~k~i~~~~IPGl~EaGw 426 (561)
||+|+|||||.|.++|+|+|+++..++. .|+..+.++|. .+..+++|||||++++. + .+.+.+..|||++|+||
T Consensus 515 ikdye~~tl~~c~l~~~i~~t~~~~~~~~~~~a~l~~~i~~~~~~~~kv~~gl~~~~~--~--~~~~~~~~iPg~~E~~~ 590 (720)
T KOG1472|consen 515 IKDYEGGTLMPCELLPEIPYTELSAIVEHPQKAKLGREIEPEIDEYFKVYPGLECFKD--G--VPQIPPRKIPGFRESGW 590 (720)
T ss_pred cccccCccccchhhccCcchhhhhhhhhhhHHHHHHHhhccccccccccccccccccc--c--ccccCcccCCCchhhcc
Confidence 9999999999999999999999999999 99999999998 67889999999999875 3 36789999999999999
Q ss_pred CCCCCCCccccccccCCCCcccHHHHHHHHHHHHHHhccCCCCCCCcCCCCCCCCCchhhhcCCCCCHHHHHHHHhcCCC
Q 008580 427 TPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQY 506 (561)
Q Consensus 427 tp~~~~~sr~r~~~~s~d~~~~~~~L~~~~~~lL~~L~~h~~A~pF~~PVd~~evPDYydIIk~PMDL~TIkkKL~~g~Y 506 (561)
.|.....++. -.....+...+..+|..|.+|..+|||.+||+..++||||++|++||||.||+.+|..+.
T Consensus 591 ~~~~~~~r~~---------~~~~~~~~s~~~~il~~l~~h~~awPf~~Pv~~~e~pdyy~~I~~pmDl~tM~~~l~~~~- 660 (720)
T KOG1472|consen 591 KPEKESYRQE---------YKKPGKLFSAIQNILDQLQNHGDAWPFLKPVNKKEVPDYYDVIKHPMDLRTMQNRLKDNQ- 660 (720)
T ss_pred CcchHHHHhh---------hcccchhhHHHHhHHhhhhcCCccCCccCccccccCCcHHHHhcccccHHHHhhhccccc-
Confidence 9987654421 012346778899999999999999999999999999999999999999999999999976
Q ss_pred CCCHHHHHHHHHHHHHHHhhhCCCCCHHHHHHHHHHHHHHHHHHhhcCC
Q 008580 507 YVTFEMFVADVKRMFANARTYNSPDTIYYKCATRLESHFQSKVQSGLHS 555 (561)
Q Consensus 507 Y~S~~eF~aDvrLIF~Ncr~YN~pdS~~yk~A~~Lek~Fe~~lkeil~~ 555 (561)
|.....|++|+.+||.||+.||+.++.+|++|..|+.+|..++++.+..
T Consensus 661 y~~~~~f~ad~~~vf~ncr~yn~~~~~y~k~~~~le~~~~~k~~~~i~~ 709 (720)
T KOG1472|consen 661 YTEVELFMADVVRVFANCRMYNGSDTQYYKCAQALEKFFLFKLNELILR 709 (720)
T ss_pred hhhHHHHHHHHHHHHhhhhccCCccchheecccchhhhhcchhhhhhhh
Confidence 8999999999999999999999999999999999999999998877543
|
|
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] | Back alignment and domain information |
|---|
| >KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] | Back alignment and domain information |
|---|
| >KOG3397 consensus Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
| >cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish | Back alignment and domain information |
|---|
| >COG5628 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 561 | ||||
| 1ygh_A | 164 | Hat Domain Of Gcn5 From Saccharomyces Cerevisiae Le | 5e-54 | ||
| 5gcn_A | 166 | Catalytic Domain Of Tetrahymena Gcn5 Histone Acetyl | 2e-49 | ||
| 1qst_A | 160 | Crystal Structure Of Tetrahymena Gcn5 Length = 160 | 4e-49 | ||
| 1m1d_A | 163 | Tetrahymena Gcn5 With Bound Bisubstrate Analog Inhi | 5e-49 | ||
| 1qsn_A | 162 | Crystal Structure Of Tetrahymena Gcn5 With Bound Co | 5e-49 | ||
| 1cm0_B | 168 | Crystal Structure Of The PcafCOENZYME-A Complex Len | 2e-47 | ||
| 1z4r_A | 168 | Human Gcn5 Acetyltransferase Length = 168 | 2e-47 | ||
| 1f68_A | 103 | Nmr Solution Structure Of The Bromodomain From Huma | 9e-24 | ||
| 3d7c_A | 112 | Crystal Structure Of The Bromodomain Of Human Gcn5, | 1e-23 | ||
| 3gg3_A | 119 | Crystal Structure Of The Bromodomain Of Human Pcaf | 3e-23 | ||
| 1n72_A | 118 | Structure And Ligand Of A Histone Acetyltransferase | 4e-23 | ||
| 3qzt_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 7e-22 | ||
| 3qzs_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 2e-21 | ||
| 2ri7_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 3e-21 | ||
| 3qzv_A | 174 | Crystal Structure Of Bptf Phd-Linker-Bromo In Compl | 3e-21 | ||
| 3uv2_A | 126 | Crystal Structure Of The Bromodomain Of Human Nucle | 5e-21 | ||
| 2f6j_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 1e-20 | ||
| 1e6i_A | 121 | Bromodomain From Gcn5 Complexed With Acetylated H4 | 8e-20 | ||
| 4don_A | 145 | Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy | 1e-14 | ||
| 3jvj_A | 131 | Crystal Structure Of The Bromodomain 1 In Mouse Brd | 2e-14 | ||
| 2oss_A | 127 | Crystal Structure Of The Bromo Domain 1 In Human Br | 2e-14 | ||
| 4hbw_A | 127 | Crystal Structure Of The First Bromodomain Of Human | 2e-14 | ||
| 3nxb_A | 116 | Crystal Structure Of The Bromodomain Of Human Cecr2 | 3e-14 | ||
| 2rfj_A | 119 | Crystal Structure Of The Bromo Domain 1 In Human Br | 2e-13 | ||
| 4a9e_A | 154 | N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- | 7e-13 | ||
| 2ydw_A | 153 | Crystal Structure Of The First Bromodomain Of Human | 7e-13 | ||
| 3rcw_A | 135 | Crystal Structure Of The Bromodomain Of Human Brd1 | 8e-13 | ||
| 2wp2_A | 120 | Structure Of Brdt Bromodomain Bd1 Bound To A Diacet | 2e-12 | ||
| 2l5e_A | 128 | Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt | 2e-12 | ||
| 2yw5_A | 138 | Solution Structure Of The Bromodomain From Human Br | 3e-12 | ||
| 2nxb_A | 123 | Crystal Structure Of Human Bromodomain Containing P | 3e-12 | ||
| 3aad_A | 292 | Structure Of The Histone Chaperone Cia/asf1-double | 7e-12 | ||
| 3uv4_A | 158 | Crystal Structure Of The Second Bromodomain Of Huma | 8e-12 | ||
| 3uv5_A | 265 | Crystal Structure Of The Tandem Bromodomains Of Hum | 9e-12 | ||
| 1eqf_A | 280 | Crystal Structure Of The Double Bromodomain Module | 1e-11 | ||
| 2e7o_A | 112 | Solution Structure Of The Bromodomain From Human Br | 1e-11 | ||
| 3oni_A | 114 | Crystal Structure Of The Second Bromodomain Of Huma | 1e-11 | ||
| 2dvv_A | 112 | Crystal Structure Of The Second Bromodomain Of The | 1e-11 | ||
| 3g0l_A | 117 | Crystal Structure Of Human Bromodomain Adjacent To | 1e-11 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 2e-11 | ||
| 2d9e_A | 121 | Solution Structure Of The Bromodomain Of Peregrin L | 2e-11 | ||
| 2g4a_A | 116 | Solution Structure Of A Bromodomain From Ring3 Prot | 2e-11 | ||
| 2wp1_A | 126 | Structure Of Brdt Bromodomain 2 Bound To An Acetyla | 2e-11 | ||
| 3hmh_A | 155 | Crystal Structure Of The Second Bromodomain Of Huma | 4e-11 | ||
| 3dwy_A | 119 | Crystal Structure Of The Bromodomain Of Human Crebb | 4e-11 | ||
| 1jsp_B | 121 | Nmr Structure Of Cbp Bromodomain In Complex With P5 | 4e-11 | ||
| 2yyn_A | 135 | Crystal Sturcture Of Human Bromodomain Protein Leng | 4e-11 | ||
| 3i3j_A | 124 | Crystal Structure Of The Bromodomain Of Human Ep300 | 9e-11 | ||
| 2r10_A | 361 | Structure Of An Acetylated Rsc4 Tandem Bromodomain | 9e-11 | ||
| 2r0v_A | 346 | Structure Of The Rsc4 Tandem Bromodomain Acetylated | 1e-10 | ||
| 3jvl_A | 120 | Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le | 2e-10 | ||
| 2oo1_A | 113 | Crystal Structure Of The Bromo Domain 2 Of Human Br | 2e-10 | ||
| 2e7n_A | 117 | Solution Structure Of The Second Bromodomain From H | 2e-10 | ||
| 1x0j_A | 122 | Crystal Structure Analysis Of The N-Terminal Bromod | 3e-10 | ||
| 2i8n_A | 114 | Solution Structure Of The Second Bromodomain Of Brd | 3e-10 | ||
| 3aqa_A | 128 | Crystal Structure Of The Human Brd2 Bd1 Bromodomain | 3e-10 | ||
| 2r0y_A | 311 | Structure Of The Rsc4 Tandem Bromodomain In Complex | 1e-09 | ||
| 2r0s_A | 285 | Crystal Structure Of The Rsc4 Tandem Bromodomain Le | 1e-09 | ||
| 3hme_A | 123 | Crystal Structure Of Human Bromodomain Containing 9 | 1e-09 | ||
| 2ouo_A | 130 | Crystal Structure Of The Bromo Domain 2 In Human Br | 3e-09 | ||
| 2lsp_B | 128 | Solution Structures Of Brd4 Second Bromodomain With | 3e-09 | ||
| 2dww_A | 114 | Crystal Structure Of Bromodomain-Containing Protein | 2e-08 | ||
| 3mb3_A | 135 | Crystal Structure Of The Second Bromodomain Of Plec | 2e-08 | ||
| 3q2e_A | 123 | Crystal Structure Of The Second Bromodomain Of Huma | 3e-08 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 4e-08 | ||
| 2i7k_A | 117 | Solution Structure Of The Bromodomain Of Human Brd7 | 2e-07 | ||
| 3iu5_A | 116 | Crystal Structure Of The First Bromodomain Of Human | 2e-07 | ||
| 3lxj_A | 136 | Crystal Structure Of The Bromodomain Of Human Aaa D | 8e-07 | ||
| 3k2j_A | 130 | Crystal Structure Of The 3rd Bromodomain Of Human P | 8e-07 | ||
| 2ktb_B | 121 | Solution Structure Of The Second Bromodomain Of Hum | 9e-07 | ||
| 3ljw_A | 120 | Crystal Structure Of The Second Bromodomain Of Huma | 1e-06 | ||
| 3hmf_A | 116 | Crystal Structure Of The Second Bromodomain Of Huma | 1e-06 | ||
| 3tlp_A | 150 | Crystal Structure Of The Fourth Bromodomain Of Huma | 2e-06 | ||
| 3fkm_X | 166 | Plasmodium Falciparum Bromodomain-Containing Protei | 5e-06 | ||
| 3dai_A | 130 | Crystal Structure Of The Bromodomain Of The Human A | 2e-05 | ||
| 2dat_A | 123 | Solution Structure Of The Bromodomain Of Human SwiS | 3e-05 | ||
| 3g0j_A | 124 | Crystal Structure Of The Fifth Bromodomain Of Human | 1e-04 | ||
| 2yqd_A | 120 | Solution Structure Of The Fifth Bromodomain From Mo | 2e-04 | ||
| 2h60_A | 128 | Solution Structure Of Human Brg1 Bromodomain Length | 3e-04 | ||
| 3uvd_A | 124 | Crystal Structure Of The Bromodomain Of Human Trans | 3e-04 | ||
| 2grc_A | 129 | 1.5 A Structure Of Bromodomain From Human Brg1 Prot | 3e-04 | ||
| 3mqm_A | 126 | Crystal Structure Of The Bromodomain Of Human Ash1l | 4e-04 | ||
| 2dkw_A | 131 | Solution Structure Of The Bromodomain Of Human Prot | 5e-04 |
| >pdb|1YGH|A Chain A, Hat Domain Of Gcn5 From Saccharomyces Cerevisiae Length = 164 | Back alignment and structure |
|
| >pdb|5GCN|A Chain A, Catalytic Domain Of Tetrahymena Gcn5 Histone Acetyltransferase In Complex With Coenzyme A Length = 166 | Back alignment and structure |
| >pdb|1QST|A Chain A, Crystal Structure Of Tetrahymena Gcn5 Length = 160 | Back alignment and structure |
| >pdb|1M1D|A Chain A, Tetrahymena Gcn5 With Bound Bisubstrate Analog Inhibitor Length = 163 | Back alignment and structure |
| >pdb|1QSN|A Chain A, Crystal Structure Of Tetrahymena Gcn5 With Bound Coenzyme A And Histone H3 Peptide Length = 162 | Back alignment and structure |
| >pdb|1CM0|B Chain B, Crystal Structure Of The PcafCOENZYME-A Complex Length = 168 | Back alignment and structure |
| >pdb|1Z4R|A Chain A, Human Gcn5 Acetyltransferase Length = 168 | Back alignment and structure |
| >pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 | Back alignment and structure |
| >pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 | Back alignment and structure |
| >pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 | Back alignment and structure |
| >pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 | Back alignment and structure |
| >pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 | Back alignment and structure |
| >pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 | Back alignment and structure |
| >pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 | Back alignment and structure |
| >pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 | Back alignment and structure |
| >pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 | Back alignment and structure |
| >pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 | Back alignment and structure |
| >pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 | Back alignment and structure |
| >pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 | Back alignment and structure |
| >pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 | Back alignment and structure |
| >pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 | Back alignment and structure |
| >pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 | Back alignment and structure |
| >pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 | Back alignment and structure |
| >pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 | Back alignment and structure |
| >pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 | Back alignment and structure |
| >pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 | Back alignment and structure |
| >pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 | Back alignment and structure |
| >pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 | Back alignment and structure |
| >pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 | Back alignment and structure |
| >pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 | Back alignment and structure |
| >pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 | Back alignment and structure |
| >pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 | Back alignment and structure |
| >pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 | Back alignment and structure |
| >pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 | Back alignment and structure |
| >pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 | Back alignment and structure |
| >pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 | Back alignment and structure |
| >pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 | Back alignment and structure |
| >pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 | Back alignment and structure |
| >pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 | Back alignment and structure |
| >pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 | Back alignment and structure |
| >pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 | Back alignment and structure |
| >pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 | Back alignment and structure |
| >pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 | Back alignment and structure |
| >pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 | Back alignment and structure |
| >pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 | Back alignment and structure |
| >pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 | Back alignment and structure |
| >pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 | Back alignment and structure |
| >pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 | Back alignment and structure |
| >pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 | Back alignment and structure |
| >pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 | Back alignment and structure |
| >pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 | Back alignment and structure |
| >pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 | Back alignment and structure |
| >pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 | Back alignment and structure |
| >pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 | Back alignment and structure |
| >pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 | Back alignment and structure |
| >pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 | Back alignment and structure |
| >pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 | Back alignment and structure |
| >pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 | Back alignment and structure |
| >pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 | Back alignment and structure |
| >pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 | Back alignment and structure |
| >pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 | Back alignment and structure |
| >pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 | Back alignment and structure |
| >pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 | Back alignment and structure |
| >pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 | Back alignment and structure |
| >pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 | Back alignment and structure |
| >pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 | Back alignment and structure |
| >pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 | Back alignment and structure |
| >pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 | Back alignment and structure |
| >pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 | Back alignment and structure |
| >pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 | Back alignment and structure |
| >pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 | Back alignment and structure |
| >pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 | Back alignment and structure |
| >pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 | Back alignment and structure |
| >pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 | Back alignment and structure |
| >pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 | Back alignment and structure |
| >pdb|3MQM|A Chain A, Crystal Structure Of The Bromodomain Of Human Ash1l Length = 126 | Back alignment and structure |
| >pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 561 | |||
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 1e-90 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 6e-82 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 9e-81 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 2e-48 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 3e-48 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 1e-47 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 1e-47 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 2e-47 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 5e-47 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 8e-47 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 6e-36 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 7e-46 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 3e-36 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 1e-45 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 2e-45 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 2e-45 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 3e-45 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 3e-45 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 8e-44 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 2e-42 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 4e-42 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 5e-42 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-41 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 3e-41 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 4e-41 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 7e-41 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 1e-40 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 4e-40 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 6e-40 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 6e-40 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 9e-40 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-39 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 8e-39 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 1e-38 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 4e-38 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 5e-38 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 3e-37 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 3e-26 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 3e-36 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 2e-28 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 8e-32 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 1e-28 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 8e-25 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 6e-19 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 1e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 2e-07 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 2e-07 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 5e-07 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 8e-07 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 3e-06 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 4e-06 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 5e-06 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 7e-06 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 8e-06 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 1e-05 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 2e-05 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 2e-05 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 3e-05 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 5e-05 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 7e-05 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 8e-05 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 1e-04 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 2e-04 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 2e-04 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 2e-04 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 3e-04 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 3e-04 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 3e-04 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 4e-04 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 4e-04 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 5e-04 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 5e-04 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 5e-04 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 7e-04 |
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164 | Back alignment and structure |
|---|
Score = 275 bits (704), Expect = 1e-90
Identities = 97/163 (59%), Positives = 122/163 (74%), Gaps = 1/163 (0%)
Query: 209 LKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIR-GNVVVG 267
++F ++ND E+M+ L GLKNIF +QLP MPKEYI RLV DRSH S+ VIR VVG
Sbjct: 2 IEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVG 61
Query: 268 GITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVG 327
GITYRP+ ++F EI FCAI++ EQV+GYG LMNHLK + R+ + +FLTYADN A+G
Sbjct: 62 GITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIG 121
Query: 328 YFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTD 370
YF KQGFTKEI L+K W GYIKDY+GG LM+C + P++ Y D
Sbjct: 122 YFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD 164
|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Length = 188 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 561 | |||
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 99.96 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.94 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.94 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.94 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.94 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.94 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.94 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.94 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.94 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.94 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.94 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.93 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.93 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 99.93 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.93 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.93 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.93 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.93 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.93 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.93 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.93 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.93 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.93 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.93 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.93 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.93 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.92 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.91 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.91 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 99.9 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.9 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.9 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.89 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.89 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.89 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.88 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.88 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.87 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.86 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.85 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.84 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.8 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.79 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.71 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 99.61 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 99.56 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.53 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 99.47 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 99.47 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 99.47 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.46 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.45 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 99.45 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 99.45 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 99.45 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 99.45 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 99.44 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 99.43 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.43 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 99.42 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 99.42 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 99.42 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 99.41 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 99.41 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 99.41 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.4 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 99.4 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 99.4 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 99.4 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.39 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 99.39 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 99.39 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.39 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 99.38 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 99.37 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 99.37 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 99.37 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 99.37 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 99.36 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 99.36 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 99.35 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 99.34 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 99.34 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 99.34 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 99.33 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 99.33 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 99.33 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 99.33 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 99.33 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.32 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 99.32 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 99.32 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 99.32 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 99.32 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 99.32 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 99.32 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.31 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 99.31 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 99.31 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 99.3 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 99.3 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 99.3 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 99.29 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 99.29 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 99.29 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.29 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 99.29 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 99.29 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 99.29 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 99.29 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 99.28 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 99.28 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 99.28 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 99.28 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 99.27 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 99.27 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 99.26 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 99.26 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 99.26 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 99.25 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 99.25 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 99.25 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 99.25 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 99.25 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 99.25 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 99.24 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 99.24 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 99.23 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 99.23 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 99.23 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 99.23 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 99.23 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 99.22 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 99.22 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 99.22 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 99.2 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 99.2 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 99.2 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 99.2 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 99.2 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 99.19 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 99.19 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 99.19 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 99.18 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 99.18 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 99.17 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 99.17 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 99.17 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 99.17 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 99.17 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 99.16 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.16 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 99.15 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 99.13 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 99.13 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 99.12 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 99.1 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 99.1 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 99.1 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 99.09 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 99.09 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 99.09 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 99.09 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 99.07 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 99.06 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 99.05 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 99.03 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 99.02 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 99.02 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 99.01 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 98.99 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 98.99 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 98.98 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 98.98 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 98.98 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 98.97 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 98.97 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 98.97 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 98.94 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 98.93 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 98.93 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 98.93 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 98.91 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 98.89 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.89 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.84 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 98.81 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 98.76 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 98.72 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.68 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 98.57 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 98.51 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 98.5 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 98.49 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 98.48 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 98.41 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 98.4 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 98.34 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 98.24 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 97.57 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 97.1 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 96.86 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 95.77 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 93.38 | |
| 3gkr_A | 336 | FEMX; FEMX, peptidoglycan, hexapeptide, transferas | 93.24 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 92.81 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 92.31 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 90.04 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 88.78 | |
| 4hkf_A | 191 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 88.74 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 87.15 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 86.46 | |
| 1rxt_A | 496 | Myristoyl-, glycylpeptide N-tetradecanoyltransfera | 85.25 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 84.03 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 80.48 |
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
Probab=99.96 E-value=8.3e-28 Score=218.50 Aligned_cols=163 Identities=58% Similarity=1.024 Sum_probs=148.4
Q ss_pred ceEEEEEeCCChhhHHHHHHHHHHHHhhhCCCCcHHHHHhhhhcCCCcEEE-EEECCeEEEEEEEeeecCCceEEEEEEE
Q 008580 208 NLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVM-VIRGNVVVGGITYRPYVSQKFGEIAFCA 286 (561)
Q Consensus 208 ~i~f~vv~nd~~~~~~~~L~~lkniF~~qLP~MpkeYI~Rlv~D~~h~slv-l~~~g~VIGGI~~R~f~~~~f~EI~f~A 286 (561)
.|+|++|+|++.++.+.||..++++|+.++|.|+.+|+.+++++..+..++ +..+|++||.+++..+......+|..++
T Consensus 1 ~i~~r~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~ivG~~~~~~~~~~~~~~i~~l~ 80 (164)
T 1ygh_A 1 KIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCA 80 (164)
T ss_dssp CEEEEEECCSSCHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHCTTCEEEEEEETTTEEEEEEEEEEEGGGTEEEEEEEE
T ss_pred CeeEEEecCCCchhhHHHHHHHHHHHHhhcccCCHHHHHHHhhCCCceEEEEECCCCEEEEEEEEEEcCCCCceEEEEEE
Confidence 489999999999999999999999999999999999999999999887744 4457899999998887656678999999
Q ss_pred eccCCcccChHHHHHHHHHHHHHhhcCceEEEEccCCcchhhhhhcCCccccccccceeeeeeecCCCceeEeeeeCCCC
Q 008580 287 ITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKL 366 (561)
Q Consensus 287 V~~~~QgKGyGt~Lmn~Lke~ak~~~gi~~~lt~AD~~AigFYkKqGFsk~i~l~~~~w~G~IKdYegatLM~C~l~p~i 366 (561)
|.+++||+|||+.||+++++++++..++..+.+.++|.|+.||+|+||+....++...|.|++++|+++++|+|.|.|.|
T Consensus 81 V~p~~rg~Gig~~ll~~~~~~a~~~~g~~~l~v~~~n~a~~~y~k~GF~~~~~~~~~~~~~~~~~~~~~~~m~~~l~~~~ 160 (164)
T 1ygh_A 81 ISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRI 160 (164)
T ss_dssp ECTTCCCTTHHHHHHHHHHHHHHHHSCCCEEEEEECGGGHHHHHHTTCBSSCCSCHHHHBTTBCCTTCCEEEEEECCCCC
T ss_pred ECHHHcCCCHHHHHHHHHHHHHHhcCCceEEEEecCChHHHHHHHcCCEecceeccceEEEEEEEecCeEEEEeeccccC
Confidence 99999999999999999999998635666777788888899999999999999999999999999999999999999999
Q ss_pred Cccc
Q 008580 367 PYTD 370 (561)
Q Consensus 367 ~Y~~ 370 (561)
+|++
T Consensus 161 ~~~~ 164 (164)
T 1ygh_A 161 RYLD 164 (164)
T ss_dssp CCCC
T ss_pred cCCC
Confidence 9985
|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 561 | ||||
| d1ygha_ | 164 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 1e-57 | |
| d1z4ra1 | 162 | d.108.1.1 (A:497-658) Catalytic domain of GCN5 his | 2e-55 | |
| d1qsra_ | 162 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 6e-54 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 2e-32 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 3e-32 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 7e-31 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 1e-30 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 4e-30 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 7e-29 | |
| d1n71a_ | 180 | d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera | 1e-05 | |
| d1vkca_ | 149 | d.108.1.1 (A:) Putative acetyltransferase PF0028 { | 3e-05 | |
| d1cjwa_ | 166 | d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep | 8e-05 | |
| d1y7ra1 | 133 | d.108.1.1 (A:1-133) Hypothetical protein SA2161 {S | 1e-04 | |
| d1sqha_ | 297 | d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr | 3e-04 | |
| d2gana1 | 182 | d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P | 4e-04 | |
| d2atra1 | 137 | d.108.1.1 (A:1-137) Probable acetyltransferase SP0 | 4e-04 | |
| d1y9wa1 | 140 | d.108.1.1 (A:1-140) Probable acetyltransferase BC2 | 0.002 |
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 188 bits (477), Expect = 1e-57
Identities = 96/163 (58%), Positives = 122/163 (74%), Gaps = 1/163 (0%)
Query: 209 LKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVI-RGNVVVG 267
++F ++ND E+M+ L GLKNIF +QLP MPKEYI RLV DRSH S+ VI + VVG
Sbjct: 2 IEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVG 61
Query: 268 GITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVG 327
GITYRP+ ++F EI FCAI++ EQV+GYG LMNHLK + R+ + +FLTYADN A+G
Sbjct: 62 GITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIG 121
Query: 328 YFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTD 370
YF KQGFTKEI L+K W GYIKDY+GG LM+C + P++ Y D
Sbjct: 122 YFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD 164
|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166 | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Length = 133 | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Length = 137 | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Length = 140 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 561 | |||
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 100.0 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 100.0 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 100.0 | |
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.94 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.93 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.93 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.93 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.92 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 99.64 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 99.56 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.52 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 99.49 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 99.48 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.46 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 99.42 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 99.41 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 99.4 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.4 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 99.4 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.4 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 99.39 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 99.39 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.38 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 99.38 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 99.37 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 99.36 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.35 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 99.35 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.33 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 99.32 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 99.31 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 99.3 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 99.29 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 99.28 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 99.27 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 99.26 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 99.23 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.2 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 99.18 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 99.14 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 99.14 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.13 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 99.12 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 99.11 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 99.11 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 99.1 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 99.09 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 99.04 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 98.95 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 98.83 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 98.79 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 98.77 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 98.75 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 98.74 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 98.7 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 98.64 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 98.56 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 98.56 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 98.52 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.51 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 97.88 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 97.87 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 97.55 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 97.04 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 96.91 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 96.52 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 96.27 | |
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 96.15 | |
| d1ne9a2 | 171 | Peptidyltransferase FemX {Weissella viridescens [T | 95.43 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 95.4 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 91.41 |
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=8.4e-47 Score=352.28 Aligned_cols=158 Identities=52% Similarity=0.976 Sum_probs=154.0
Q ss_pred CceEEEEEeCCC----hhhHHHHHHHHHHHHhhhCCCCcHHHHHhhhhcCCCcEEEEEECCeEEEEEEEeeecCCceEEE
Q 008580 207 GNLKFVCLSNDG----IDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEI 282 (561)
Q Consensus 207 g~i~f~vv~nd~----~~~~~~~L~~lkniF~~qLP~MpkeYI~Rlv~D~~h~slvl~~~g~VIGGI~~R~f~~~~f~EI 282 (561)
|+|+|+++.||. +++.++||++++|+|++|||+||++||.|+++|++|.+++++++|+|||+||++++++.+++||
T Consensus 1 ~~i~~~~~~n~~~~~~~~~~~~~L~~~~~iF~~~lp~m~~~yi~r~~~d~~~~~~v~~~~~~iIG~i~~~~~~~~~~aeI 80 (162)
T d1z4ra1 1 GIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEI 80 (162)
T ss_dssp CSEEEEEECCSSCTTSCHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHTCTTCEEEEEEETTEEEEEEEEEEETTTTEEEE
T ss_pred CEEEEEEecCCCCCccCHHHHHHHHHHHHHHHHhCCCCcHHHHHHHhcCCCceEEEEEECCEEEEEEEEEEECCCCEEEE
Confidence 899999999974 5688999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEeccCCcccChHHHHHHHHHHHHHhhcCceEEEEccCCcchhhhhhcCCccccccccceeeeeeecCCCceeEeeee
Q 008580 283 AFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKI 362 (561)
Q Consensus 283 ~f~AV~~~~QgKGyGt~Lmn~Lke~ak~~~gi~~~lt~AD~~AigFYkKqGFsk~i~l~~~~w~G~IKdYegatLM~C~l 362 (561)
.+|||+++|||+|||++||+++++++++ .|+.++++++++.|++||+|+||++++++|+.+|.||||||+|||||+|+|
T Consensus 81 ~~laV~~~~qgkGiG~~Lm~~l~~~~~~-~g~~~i~~~~~~~A~~fY~k~GF~~~~~~~~~~~~~~ikdy~~~~lm~~~~ 159 (162)
T d1z4ra1 81 VFCAVTSNEQVKGYGTHLMNHLKEYHIK-HNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECEL 159 (162)
T ss_dssp EEEEECGGGCSSSHHHHHHHHHHHHHHH-TTCCEEEEEECGGGHHHHHHTTEESCCCSCHHHHTTTSCCCTTCEEEEEEC
T ss_pred EEEEEChhhhhhhHHHHHHHHHHHHHHH-CCCcEEEEecCcchHHHHHhCCCeEeccCchhHhcCCccCCCCeEEEEEec
Confidence 9999999999999999999999999998 899999999999999999999999999999999999999999999999999
Q ss_pred CCC
Q 008580 363 DPK 365 (561)
Q Consensus 363 ~p~ 365 (561)
+|+
T Consensus 160 ~p~ 162 (162)
T d1z4ra1 160 NPR 162 (162)
T ss_dssp CCC
T ss_pred CCC
Confidence 996
|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|