Citrus Sinensis ID: 008581

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-
MDSEEDDFYSGEAMDDDNDYYNSDDAAADYGVEDDEDDDDGYGFIEEDPDHDDFDNASFRRQQHSYTVLREADIKCQQEDDITKVSTVLSISRVDASILLRHYNWSVSKVHDAWFADEDAVRKSVGFLDKPVVEFSNARELTCGICFDTYSCDKVVSAACGHPFCRACWRVNDGPGCLMLRCPDPSCCAAVGQDMIDMLASDEDKKKYSRYLLRSYVEDNRKTKWCPAPGCEHAIDFAAGSGNFDVSCLCSYNFCWNCTEEAHRPVDCGTVAKWILKNCAESENMNWILANSKPCPKCKRPIEKNQGCMHMTCSPPCKFEFCWLCLGAWSDHGERTGGFYACNRYETAKQQGDYDETERRREMAKNSLEKYTHYYERWASNQSSRQKALADLHQMQTVHLEKLSDIQCTPESQLKFIIDAWLQIVECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLERLHQCAEKELLQFLNDESQSKEFNDFRTKLAGLTSVTKNYFENLVRALENGLADVDSHAACSKTTNSKYGGGGGASKGKSGRGKGSGKIGGSHDAGR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccEEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccccccccccccHHHccccccccccccHHHHHHHHHHHHHcccHHHHHccccccccccccEECccccccEEEccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccc
**********************************DEDDDDGYGFIEEDPD************QHSYTVLREADIKCQQEDDITKVSTVLSISRVDASILLRHYNWSVSKVHDAWFADEDAVRKSVGFLDKPVVEFSNARELTCGICFDTYSCDKVVSAACGHPFCRACWRVNDGPGCLMLRCPDPSCCAAVGQDMIDMLASDEDKKKYSRYLLRSYVEDNRKTKWCPAPGCEHAIDFAAGSGNFDVSCLCSYNFCWNCTEEAHRPVDCGTVAKWILKNCAESENMNWILANSKPCPKCKRPIEKNQGCMHMTCSPPCKFEFCWLCLGAWSDHGERTGGFYACNRYETAKQQ*************KNSLEKYTHYYERWASNQSSRQKALADLHQMQTVHLEKLSDIQCTPESQLKFIIDAWLQIVECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLERLHQCAEKELLQFLNDESQSKEFNDFRTKLAGLTSVTKNYFENLVRALENGLAD*******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSEEDDFYSGEAMDDDNDYYNSDDAAADYGVEDDEDDDDGYGFIEEDPDHDDFDNASFRRQQHSYTVLREADIKCQQEDDITKVSTVLSISRVDASILLRHYNWSVSKVHDAWFADEDAVRKSVGFLDKPVVEFSNARELTCGICFDTYSCDKVVSAACGHPFCRACWRVNDGPGCLMLRCPDPSCCAAVGQDMIDMLASDEDKKKYSRYLLRSYVEDNRKTKWCPAPGCEHAIDFAAGSGNFDVSCLCSYNFCWNCTEEAHRPVDCGTVAKWILKNCAESENMNWILANSKPCPKCKRPIEKNQGCMHMTCSPPCKFEFCWLCLGAWSDHGERTGGFYACNRYETAKQQGDYDETERRREMAKNSLEKYTHYYERWASNQSSRQKALADLHQMQTVHLEKLSDIQCTPESQLKFIIDAWLQIVECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLERLHQCAEKELLQFLNDESQSKEFNDFRTKLAGLTSVTKNYFENLVRALENGLADVDSHAACSKTTNSKYGGGGGASKGKSGRGKGSGKIGGSHDAGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable E3 ubiquitin-protein ligase ARI7 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.confidentQ84RR0
Probable E3 ubiquitin-protein ligase ARI5 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.probableQ8L829
Probable E3 ubiquitin-protein ligase ARI8 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.probableQ8W468

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WD2, chain A
Confidence level:very confident
Coverage over the Query: 287-347
View the alignment between query and template
View the model in PyMOL
Template: 1WIM, chain A
Confidence level:confident
Coverage over the Query: 138-220
View the alignment between query and template
View the model in PyMOL
Template: 2CT7, chain A
Confidence level:confident
Coverage over the Query: 202-283
View the alignment between query and template
View the model in PyMOL
Template: 2DAL, chain A
Confidence level:probable
Coverage over the Query: 77-118
View the alignment between query and template
View the model in PyMOL