Citrus Sinensis ID: 008581
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 561 | ||||||
| 224095704 | 569 | predicted protein [Populus trichocarpa] | 0.855 | 0.843 | 0.852 | 0.0 | |
| 224132684 | 546 | predicted protein [Populus trichocarpa] | 0.853 | 0.877 | 0.843 | 0.0 | |
| 356550364 | 589 | PREDICTED: probable E3 ubiquitin-protein | 0.843 | 0.803 | 0.829 | 0.0 | |
| 356557318 | 589 | PREDICTED: probable E3 ubiquitin-protein | 0.843 | 0.803 | 0.822 | 0.0 | |
| 356545498 | 586 | PREDICTED: probable E3 ubiquitin-protein | 0.871 | 0.834 | 0.785 | 0.0 | |
| 356538909 | 586 | PREDICTED: probable E3 ubiquitin-protein | 0.882 | 0.844 | 0.772 | 0.0 | |
| 359478116 | 587 | PREDICTED: probable E3 ubiquitin-protein | 0.873 | 0.834 | 0.787 | 0.0 | |
| 359495753 | 652 | PREDICTED: probable E3 ubiquitin-protein | 0.871 | 0.75 | 0.804 | 0.0 | |
| 224109192 | 591 | predicted protein [Populus trichocarpa] | 0.946 | 0.898 | 0.738 | 0.0 | |
| 298205054 | 581 | unnamed protein product [Vitis vinifera] | 0.871 | 0.841 | 0.804 | 0.0 |
| >gi|224095704|ref|XP_002310443.1| predicted protein [Populus trichocarpa] gi|222853346|gb|EEE90893.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 875 bits (2261), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 415/487 (85%), Positives = 446/487 (91%), Gaps = 7/487 (1%)
Query: 52 DDFDNASFRRQQHSYTVLREADIKCQQEDDITKVSTVLSISRVDASILLRHYNWSVSKVH 111
DD D+ SFR QQ SYTVL+E DI +QEDD+T+VSTVLSI+RV ASILLRHYNWSVSKVH
Sbjct: 58 DDTDDLSFRFQQ-SYTVLKEEDILNRQEDDVTRVSTVLSITRVAASILLRHYNWSVSKVH 116
Query: 112 DAWFADEDAVRKSVGFLDKPVVEFSNARELTCGICFDTYSCDKVVSAACGHPFCRACWR- 170
DAWFADEDAVRKSVG LDK VV+FSNARELTCGICF++ CDK++SAACGHPFC CW
Sbjct: 117 DAWFADEDAVRKSVGLLDKQVVQFSNARELTCGICFESIPCDKIISAACGHPFCNTCWSG 176
Query: 171 -----VNDGPGCLMLRCPDPSCCAAVGQDMIDMLASDEDKKKYSRYLLRSYVEDNRKTKW 225
+NDGPGCLMLRCPDPSC AAVGQDMI++LA DK+KYSRYLLRSY+EDNRKTKW
Sbjct: 177 YISTTINDGPGCLMLRCPDPSCRAAVGQDMINLLAPGGDKEKYSRYLLRSYIEDNRKTKW 236
Query: 226 CPAPGCEHAIDFAAGSGNFDVSCLCSYNFCWNCTEEAHRPVDCGTVAKWILKNCAESENM 285
CPAPGCE+AIDFAAGSG+FDVSCLCS++FCWNC EEAHRPVDCGTV KWILKN AESENM
Sbjct: 237 CPAPGCEYAIDFAAGSGSFDVSCLCSHSFCWNCAEEAHRPVDCGTVTKWILKNSAESENM 296
Query: 286 NWILANSKPCPKCKRPIEKNQGCMHMTCSPPCKFEFCWLCLGAWSDHGERTGGFYACNRY 345
NWILANSKPCPKCKRPIEKNQGCMH+TC+PPCKFEFCWLCLGAWSDHGERTGGFYACNRY
Sbjct: 297 NWILANSKPCPKCKRPIEKNQGCMHITCTPPCKFEFCWLCLGAWSDHGERTGGFYACNRY 356
Query: 346 ETAKQQGDYDETERRREMAKNSLEKYTHYYERWASNQSSRQKALADLHQMQTVHLEKLSD 405
E AKQ+G YDE+ERRREMAKNSLE+YTHYYERWASNQ SRQKAL DLHQMQTVHLEKLSD
Sbjct: 357 EAAKQEGAYDESERRREMAKNSLERYTHYYERWASNQLSRQKALVDLHQMQTVHLEKLSD 416
Query: 406 IQCTPESQLKFIIDAWLQIVECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLER 465
I CTPESQLKFI +AWLQIVECRRVLKWTYAYG+YL EHEHAKRQFFEYLQGEAESGLER
Sbjct: 417 IHCTPESQLKFIAEAWLQIVECRRVLKWTYAYGFYLHEHEHAKRQFFEYLQGEAESGLER 476
Query: 466 LHQCAEKELLQFLNDESQSKEFNDFRTKLAGLTSVTKNYFENLVRALENGLADVDSHAAC 525
LHQCAEKEL QFL + SKEF++FRTKLAGLTSVTKNYFENLVRALENGLADVDSH AC
Sbjct: 477 LHQCAEKELQQFLAADGPSKEFDEFRTKLAGLTSVTKNYFENLVRALENGLADVDSHGAC 536
Query: 526 SKTTNSK 532
SKTT+SK
Sbjct: 537 SKTTSSK 543
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224132684|ref|XP_002327855.1| predicted protein [Populus trichocarpa] gi|222837264|gb|EEE75643.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356550364|ref|XP_003543557.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356557318|ref|XP_003546964.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356545498|ref|XP_003541178.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538909|ref|XP_003537943.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359478116|ref|XP_003632072.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Vitis vinifera] gi|147800085|emb|CAN64272.1| hypothetical protein VITISV_008933 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359495753|ref|XP_002268068.2| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224109192|ref|XP_002315117.1| predicted protein [Populus trichocarpa] gi|222864157|gb|EEF01288.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|298205054|emb|CBI38350.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 561 | ||||||
| TAIR|locus:2065954 | 562 | ARI7 "ARIADNE 7" [Arabidopsis | 0.864 | 0.862 | 0.771 | 5.1e-223 | |
| TAIR|locus:2206315 | 567 | ARI8 "ARIADNE 8" [Arabidopsis | 0.860 | 0.851 | 0.746 | 2e-214 | |
| TAIR|locus:2045188 | 543 | ARI9 "ARIADNE 9" [Arabidopsis | 0.814 | 0.841 | 0.564 | 3.8e-156 | |
| TAIR|locus:2045223 | 514 | ARI10 "ARIADNE 10" [Arabidopsi | 0.784 | 0.856 | 0.580 | 3.1e-154 | |
| DICTYBASE|DDB_G0286961 | 520 | rbrA "IBR zinc finger-containi | 0.787 | 0.85 | 0.355 | 1.1e-78 | |
| POMBASE|SPAC328.02 | 504 | SPAC328.02 "ubiquitin-protein | 0.729 | 0.811 | 0.337 | 3.1e-67 | |
| ASPGD|ASPL0000014787 | 511 | AN3689 [Emericella nidulans (t | 0.741 | 0.814 | 0.337 | 3.2e-65 | |
| UNIPROTKB|G4NDZ4 | 522 | MGG_00859 "Ariadne-1" [Magnapo | 0.828 | 0.890 | 0.322 | 3.2e-65 | |
| DICTYBASE|DDB_G0289043 | 1818 | DDB_G0289043 [Dictyostelium di | 0.600 | 0.185 | 0.344 | 9.3e-62 | |
| TAIR|locus:2116184 | 597 | ARI1 "ARIADNE 1" [Arabidopsis | 0.809 | 0.760 | 0.318 | 1e-59 |
| TAIR|locus:2065954 ARI7 "ARIADNE 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2127 (753.8 bits), Expect = 5.1e-223, Sum P(2) = 5.1e-223
Identities = 381/494 (77%), Positives = 431/494 (87%)
Query: 44 FIEEDPDHDDFDNASFRRQQHSYTVLREADIKCQQEDDITKVSTVLSISRVDASILLRHY 103
F+EED D D AS R Q++ + VLRE DI+ Q D+I +VS VLSI+ V+ASILLRH+
Sbjct: 40 FVEEDAD-DSAMIASHRSQKN-FCVLREEDIRRHQMDNIERVSVVLSITEVEASILLRHF 97
Query: 104 NWSVSKVHDAWFADEDAVRKSVGFLDKPVVEFSNARELTCGICFDTYSCDKVVSAACGHP 163
+WSV +VHD WFADE+ VRK+VG L+ VV S+ ELTCGICFD+Y +K+ S +CGHP
Sbjct: 98 HWSVGRVHDEWFADEERVRKTVGILESHVVPPSDDSELTCGICFDSYPPEKIASVSCGHP 157
Query: 164 FCRACWR------VNDGPGCLMLRCPDPSCCAAVGQDMIDMLASDEDKKKYSRYLLRSYV 217
FC CW +NDGPGCLMLRCPDPSC AAVG DM+D LAS+++K+KY+RY LRSY+
Sbjct: 158 FCTTCWTGYISTTINDGPGCLMLRCPDPSCLAAVGHDMVDKLASEDEKEKYNRYFLRSYI 217
Query: 218 EDNRKTKWCPAPGCEHAIDFAAGSGNFDVSCLCSYNFCWNCTEEAHRPVDCGTVAKWILK 277
EDNRK KWCPAPGC+ AIDF AGSGN+DVSCLCS++FCWNCTEEAHRPVDC TV+KWILK
Sbjct: 218 EDNRKMKWCPAPGCDFAIDFVAGSGNYDVSCLCSFSFCWNCTEEAHRPVDCSTVSKWILK 277
Query: 278 NCAESENMNWILANSKPCPKCKRPIEKNQGCMHMTCSPPCKFEFCWLCLGAWSDHGERTG 337
N AESENMNWILANSKPCP+CKRPIEKNQGCMHMTC+PPCK+EFCWLCLGAW DHGERTG
Sbjct: 278 NSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKYEFCWLCLGAWMDHGERTG 337
Query: 338 GFYACNRYETAKQQGDYDETERRREMAKNSLEKYTHYYERWASNQSSRQKALADLHQMQT 397
GFYACNRYE AKQ+G YDETERRREMAKNSLE+YTHYYERWASNQ+SRQKA+ADL Q Q
Sbjct: 338 GFYACNRYEVAKQEGQYDETERRREMAKNSLERYTHYYERWASNQTSRQKAMADLQQAQM 397
Query: 398 VHLEKLSDIQCTPESQLKFIIDAWLQIVECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQG 457
+LEKLSD QCTPESQLKFI++AWLQI+ECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQG
Sbjct: 398 QNLEKLSDKQCTPESQLKFILEAWLQIIECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQG 457
Query: 458 EAESGLERLHQCAEKELLQFLNDESQSKEFNDFRTKLAGLTSVTKNYFENLVRALENGLA 517
EAESGLERLHQC EK+L+QFL E SK+FNDFRTKLAGLTSVTKNYFENLV+ALENGLA
Sbjct: 458 EAESGLERLHQCVEKDLVQFLIAEGPSKDFNDFRTKLAGLTSVTKNYFENLVKALENGLA 517
Query: 518 DVDSHAACS-KTTN 530
DVDSHAACS K+T+
Sbjct: 518 DVDSHAACSSKSTS 531
|
|
| TAIR|locus:2206315 ARI8 "ARIADNE 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045188 ARI9 "ARIADNE 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045223 ARI10 "ARIADNE 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286961 rbrA "IBR zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC328.02 SPAC328.02 "ubiquitin-protein ligase involved in sporulation" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000014787 AN3689 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NDZ4 MGG_00859 "Ariadne-1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0289043 DDB_G0289043 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116184 ARI1 "ARIADNE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 561 | |||
| smart00647 | 64 | smart00647, IBR, In Between Ring fingers | 5e-18 | |
| pfam01485 | 63 | pfam01485, IBR, IBR domain | 1e-11 | |
| pfam01485 | 63 | pfam01485, IBR, IBR domain | 8e-05 |
| >gnl|CDD|214763 smart00647, IBR, In Between Ring fingers | Back alignment and domain information |
|---|
Score = 77.8 bits (192), Expect = 5e-18
Identities = 30/64 (46%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
Query: 206 KKYSRYLLRSYVEDNRKTKWCPAPGCEHAIDFAAGSGNFDVSC-LCSYNFCWNCTEEAHR 264
+KY R LL SYVE N KWCPAP C AI G V+C C ++FC+ C H
Sbjct: 1 EKYERLLLESYVESNPDLKWCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCFRCKVPWHS 60
Query: 265 PVDC 268
PV C
Sbjct: 61 PVSC 64
|
the domains occurs between pairs og RING fingers. Length = 64 |
| >gnl|CDD|216524 pfam01485, IBR, IBR domain | Back alignment and domain information |
|---|
| >gnl|CDD|216524 pfam01485, IBR, IBR domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 561 | |||
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.97 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 99.89 | |
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 99.27 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 99.13 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.56 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.07 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 98.02 | |
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 97.97 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.95 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 97.92 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 97.84 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 97.82 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 97.79 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.74 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 97.71 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.64 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.6 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 97.55 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 97.44 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.34 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.3 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.18 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.17 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.17 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.16 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.02 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.01 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 96.92 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 96.8 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 96.39 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.29 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 96.23 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 96.22 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 96.08 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.61 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 95.51 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.49 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 95.42 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.32 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.98 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.97 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 94.49 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 94.43 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 93.99 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 93.64 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 93.33 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.13 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 92.97 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.85 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.68 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 91.92 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.49 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 90.71 | |
| PRK00420 | 112 | hypothetical protein; Validated | 90.04 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 89.71 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 89.63 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.27 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 88.58 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.47 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 87.02 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 86.97 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 86.1 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.91 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 85.6 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 85.45 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 85.09 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 84.96 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 84.7 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 84.66 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 83.95 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 83.86 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 83.85 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.73 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.69 | |
| PHA00626 | 59 | hypothetical protein | 83.37 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 82.62 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 82.23 | |
| PF09297 | 32 | zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do | 81.33 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 81.0 | |
| PF14952 | 44 | zf-tcix: Putative treble-clef, zinc-finger, Zn-bin | 80.92 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 80.86 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.64 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.45 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 80.19 |
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-71 Score=597.56 Aligned_cols=432 Identities=47% Similarity=0.905 Sum_probs=392.0
Q ss_pred EecHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHcCCChhhhhHhhhcChHHHHHHcCCCCCCccccCCCCcccccccc
Q 008581 68 VLREADIKCQQEDDITKVSTVLSISRVDASILLRHYNWSVSKVHDAWFADEDAVRKSVGFLDKPVVEFSNARELTCGICF 147 (561)
Q Consensus 68 vlt~~~i~~~~~~~i~~v~~vl~i~~~~a~~LL~~~~W~~~~l~e~~~~~~~~~~~~~gl~~~~~~~~~~~~~~~C~IC~ 147 (561)
|++.++|...|.++|..|+++|++++.+|++||.+|.|+.+++++.|+.+++.++..+|+...+ .......|.||+
T Consensus 2 vl~~~~~~~~~~~~i~~~~~~ls~~~~~~~~ll~~~~W~~~kl~~~~~~~~~~~~~~~g~~~~~----~~~~~~~c~ic~ 77 (444)
T KOG1815|consen 2 VLTPDDIAALMREDIIEVSDILSLSHAVARILLAHFCWNVEKLLEEWVEDEETGCFFVGLLLWP----KKKGDVQCGICV 77 (444)
T ss_pred CCchHhhhHHhHhhHHHHHHhhcCCHHHHHHHHHhcCcchHHHHHHHHhcCcchhhhccccccC----CCCccccCCccc
Confidence 6889999999999999999999999999999999999999999999999999999999986653 345578999999
Q ss_pred ccccCCCeeeccCCCccccccce------eccCCcccccccCCCCCCCcchhhHHhhhCCh-HHHHHHHHHHHHHHHhcC
Q 008581 148 DTYSCDKVVSAACGHPFCRACWR------VNDGPGCLMLRCPDPSCCAAVGQDMIDMLASD-EDKKKYSRYLLRSYVEDN 220 (561)
Q Consensus 148 e~~~~~~~~~l~CgH~fC~~C~~------i~~g~~~~~i~CP~~~C~~~v~~~~i~~ll~~-e~~~ky~~~l~~~~v~~~ 220 (561)
+.++. .+..+.|||.||..||. |..+.... |+||..+|...+..+.|..++++ +..++|.+++.++|++.+
T Consensus 78 ~~~~~-~~~~~~c~H~~c~~cw~~yl~~kI~~~~~~~-i~cp~~~C~a~v~~~~i~~~~s~~~~~~ky~~~i~~syve~~ 155 (444)
T KOG1815|consen 78 ESYDG-EIIGLGCGHPFCPPCWTGYLGTKIHEGEEAK-IKCPAHGCPALVGEDTVEKLVSDKEDKEKYQRYILRSYVEDN 155 (444)
T ss_pred CCCcc-hhhhcCCCcHHHHHHHHHHhhheeecccccc-ccCCCCCccccCCCceeeeecCCHHHHHHHHHHHHHHHHhcC
Confidence 98865 67888999999999999 66665433 99999999999999999999988 599999999999999999
Q ss_pred CCceecCCCCCCCeeecccCCCCceeEecCCcccccccCcccCCCCCchhHHHHHHHhHhhhHhHHHHHhcCCCCCCCCc
Q 008581 221 RKTKWCPAPGCEHAIDFAAGSGNFDVSCLCSYNFCWNCTEEAHRPVDCGTVAKWILKNCAESENMNWILANSKPCPKCKR 300 (561)
Q Consensus 221 ~~~~~CP~~~C~~~i~~~~~~~~~~v~C~C~~~fC~~C~~~~H~p~~C~~~~~~~~k~~~~~~~~~wi~~ntK~CP~C~~ 300 (561)
..++|||+|+|++++.+. ......|.|.|++.|||.|+.+||.|.+|.....|+.+..+++++.+||..|+++||+|..
T Consensus 156 ~~lkwCP~~~C~~av~~~-~~~~~~v~C~~g~~FC~~C~~~~H~p~~C~~~~~wl~k~~~~se~~~wi~~ntk~CP~c~~ 234 (444)
T KOG1815|consen 156 VPLKWCPAPGCGLAVKFG-SLESVEVDCGCGHEFCFACGEESHSPVSCPGAKKWLKKCRDDSETINWILANTKECPKCKV 234 (444)
T ss_pred CccccCCCCCCCceeecc-CCCccceeCCCCchhHhhccccccCCCcccchHHHHHhhhhhhhhhhhhhccCccCCCccc
Confidence 999999999999999875 4556789999999999999999999999999999999999999999999999999999999
Q ss_pred ceeecCCCCceEeCCC--CcchhhhhhhcCccCCCCCCCCcccCCcchhhhhcCCchHHHHHHHHHHHHHhhhHHHHHHH
Q 008581 301 PIEKNQGCMHMTCSPP--CKFEFCWLCLGAWSDHGERTGGFYACNRYETAKQQGDYDETERRREMAKNSLEKYTHYYERW 378 (561)
Q Consensus 301 ~IEK~~GCnhm~C~~~--C~~~FCw~C~~~w~~h~~~~g~~y~C~~~~~~~~~~~~~~~~~~~~~~~~~l~ry~~y~~r~ 378 (561)
+|||++|||||+|. . |++.|||+|++.|..|+..+ +|.||+|...+.. . .+++++..|.||.|||+||
T Consensus 235 ~iek~~gc~~~~~~-~~~c~~~FCw~Cl~~~~~h~~~~--~~~c~~~~~~~~~------~-~~~~a~~~l~r~~~~~~~~ 304 (444)
T KOG1815|consen 235 PIEKDGGCNHMTCK-SASCKHEFCWVCLASLSDHGSST--GYSCNRYVDGKSK------S-ARSKARRSLKRYTHYYNRW 304 (444)
T ss_pred chhccCCccccccc-cCCcCCeeceeeecccccccccc--eeeeeeeechhhh------h-HHHHHHHHHHHHHHHHhhH
Confidence 99999999999998 6 99999999999999999754 8999999764421 1 4678899999999999999
Q ss_pred hhhHHHHHHHHHHHHHHHHHHHHHHhhhcCCCchhHHHHHHHHHHHHHHHHHhhcccceecccCccchhhhhHHHHHHHH
Q 008581 379 ASNQSSRQKALADLHQMQTVHLEKLSDIQCTPESQLKFIIDAWLQIVECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGE 458 (561)
Q Consensus 379 ~~h~~s~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~fl~~a~~~l~~~r~~L~~sy~~~yy~~~~~~~~~~~fe~~Q~~ 458 (561)
++|+.+++++...+......+..++......++++++|+.+++.+|.++|++|+|||+|+||+. ...++++||++|.+
T Consensus 305 ~~~q~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~r~~l~~s~~~~~~~~--~~~~~~~fe~~q~~ 382 (444)
T KOG1815|consen 305 MEHQVSLKLEGKLLSKVEEVKKPKLSDSLSLSWIDVQFLRDAGDVLVECRRTLKWTYAYAYYLS--ENNKRNLFEDNQTD 382 (444)
T ss_pred HhhhhhhhhhhhhHHHHHHHhhhhhhcccCeeeeeeeeechhHHHHHhhhhhhhhhhhhhhhhc--ccchhhhhHHHHHH
Confidence 9999999998877777777777777777677789999999999999999999999999999997 44567999999999
Q ss_pred HHHhHHHHHHHHHHHHHHhhcccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccccc
Q 008581 459 AESGLERLHQCAEKELLQFLNDESQSKEFNDFRTKLAGLTSVTKNYFENLVRALENGLADVDSHA 523 (561)
Q Consensus 459 ~e~~~e~L~~~le~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~e~~l~~~~~~~ 523 (561)
|+..+|.|+..+|.++. +.+...+..+|.++.++|.++++|+++++..+++||.++.+..
T Consensus 383 ~~~~~e~ls~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ 442 (444)
T KOG1815|consen 383 LESAVEPLSSCLEESLK-----DISSETLAEFKQKLTDLTSYVRNRFENLLKHLEEGLEDVGSEA 442 (444)
T ss_pred HhhhhhhhHHHhccccc-----cCCcccHHHHHhhccccchhhhhHHHHHHHHHHhccccccccc
Confidence 99999999999998776 4555789999999999999999999999999999999987643
|
|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 561 | ||||
| 1wd2_A | 60 | Solution Structure Of The C-Terminal Ring From A Ri | 9e-12 |
| >pdb|1WD2|A Chain A, Solution Structure Of The C-Terminal Ring From A Ring-Ibr- Ring (Triad) Motif Length = 60 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 561 | |||
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 4e-26 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 2e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-10 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 5e-05 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 1e-04 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 1e-04 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 2e-04 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 3e-04 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 3e-04 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 4e-04 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 5e-04 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 6e-04 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 6e-04 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 7e-04 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 7e-04 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 7e-04 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 8e-04 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 8e-04 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 8e-04 |
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60 | Back alignment and structure |
|---|
Score = 100 bits (250), Expect = 4e-26
Identities = 34/61 (55%), Positives = 38/61 (62%), Gaps = 4/61 (6%)
Query: 287 WILANSKPCPKCKRPIEKNQGCMHMTCSPP-CKFEFCWLCLGAWSDHGERTGGFYACNRY 345
WI AN+K CPKC IEK+ GC HM C CK EFCW+CLG W HG +Y CNRY
Sbjct: 1 WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGS---AWYNCNRY 57
Query: 346 E 346
Sbjct: 58 N 58
|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 561 | |||
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 99.82 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 99.4 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 99.29 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 99.09 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.0 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.52 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.36 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.36 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.36 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.35 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.34 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.33 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.31 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.29 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.27 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.25 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.24 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.23 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.22 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.22 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.21 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.21 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.19 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.15 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.13 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.12 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.11 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.11 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.11 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.08 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.07 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.07 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.06 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.05 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.03 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.03 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.03 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.02 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.0 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.0 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 97.97 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 97.95 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 97.94 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 97.94 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.93 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 97.93 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 97.86 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.82 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 97.81 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.75 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 97.73 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.72 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.69 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 97.69 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.63 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 97.58 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 97.56 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.55 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 97.38 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 97.35 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 97.28 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.21 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 97.19 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 97.16 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 97.09 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.04 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 96.98 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 96.73 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 96.65 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 96.32 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 95.83 | |
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 95.15 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 94.66 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 94.42 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 93.25 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 92.88 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 92.69 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 91.28 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 90.51 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 90.02 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 89.66 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 89.32 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 88.81 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 86.0 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 85.38 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 83.58 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 83.43 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 83.39 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 82.43 | |
| 2di0_A | 71 | Activating signal cointegrator 1 complex subunit 2 | 81.82 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 81.43 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 80.89 |
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Probab=99.82 E-value=5.8e-22 Score=151.65 Aligned_cols=57 Identities=60% Similarity=1.448 Sum_probs=53.3
Q ss_pred HHHhcCCCCCCCCcceeecCCCCceEeCCC--CcchhhhhhhcCccCCCCCCCCcccCCcchh
Q 008581 287 WILANSKPCPKCKRPIEKNQGCMHMTCSPP--CKFEFCWLCLGAWSDHGERTGGFYACNRYET 347 (561)
Q Consensus 287 wi~~ntK~CP~C~~~IEK~~GCnhm~C~~~--C~~~FCw~C~~~w~~h~~~~g~~y~C~~~~~ 347 (561)
||.+++|+||+|+.+|||++|||||+|+ . |+++|||+|+++|..|+. .+|+||+|++
T Consensus 1 wi~~~~k~CP~C~~~Iek~~GCnhmtC~-~~~C~~~FCw~C~~~~~~~~~---~~y~C~~y~~ 59 (60)
T 1wd2_A 1 WIAANTKECPKCHVTIEKDGGCNHMVCR-NQNCKAEFCWVCLGPWEPHGS---AWYNCNRYNE 59 (60)
T ss_dssp CCCCCCCCCTTTCCCCSSCCSCCSSSCC-SSGGGSCCSSSSCSCSGGGGT---SSSSSCSCCC
T ss_pred CccccceECcCCCCeeEeCCCCCcEEEC-CCCcCCEEeeCcCCCcccCCC---ccccCCCccc
Confidence 7888999999999999999999999998 7 999999999999999985 6899999963
|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 561 | ||||
| d1wd2a_ | 60 | g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho | 7e-22 | |
| d2ct7a1 | 73 | g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H | 3e-14 | |
| d2ct7a1 | 73 | g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H | 5e-07 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 7e-10 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 5e-04 |
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Ariadne-1 protein homolog species: Human (Homo sapiens) [TaxId: 9606]
Score = 86.9 bits (215), Expect = 7e-22
Identities = 34/61 (55%), Positives = 39/61 (63%), Gaps = 4/61 (6%)
Query: 287 WILANSKPCPKCKRPIEKNQGCMHMTC-SPPCKFEFCWLCLGAWSDHGERTGGFYACNRY 345
WI AN+K CPKC IEK+ GC HM C + CK EFCW+CLG W HG +Y CNRY
Sbjct: 1 WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHG---SAWYNCNRY 57
Query: 346 E 346
Sbjct: 58 N 58
|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 561 | |||
| d1wd2a_ | 60 | Ariadne-1 protein homolog {Human (Homo sapiens) [T | 99.81 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 99.27 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 99.09 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 98.99 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.44 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.27 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.25 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.24 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.23 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.2 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.09 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.09 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 97.91 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 97.77 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.71 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 97.65 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.41 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 97.35 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 96.27 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 96.15 | |
| d1wd2a_ | 60 | Ariadne-1 protein homolog {Human (Homo sapiens) [T | 95.18 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 94.75 | |
| d2csva1 | 59 | Tripartite motif-containing protein 29 {Human (Hom | 86.42 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 85.36 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 84.13 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 84.0 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 82.88 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 82.19 |
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Ariadne-1 protein homolog species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81 E-value=5.8e-22 Score=149.56 Aligned_cols=58 Identities=59% Similarity=1.422 Sum_probs=53.0
Q ss_pred HHHhcCCCCCCCCcceeecCCCCceEeC-CCCcchhhhhhhcCccCCCCCCCCcccCCcchh
Q 008581 287 WILANSKPCPKCKRPIEKNQGCMHMTCS-PPCKFEFCWLCLGAWSDHGERTGGFYACNRYET 347 (561)
Q Consensus 287 wi~~ntK~CP~C~~~IEK~~GCnhm~C~-~~C~~~FCw~C~~~w~~h~~~~g~~y~C~~~~~ 347 (561)
||..|||+||+|+.+|||++|||||+|+ +.|+++|||+|+++|..|+. ++|+||+|++
T Consensus 1 wi~~ntK~CP~C~~~ieK~~GCnhM~C~~~~C~~~fCw~C~~~~~~~~~---~~~~C~~~~e 59 (60)
T d1wd2a_ 1 WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGS---AWYNCNRYNE 59 (60)
T ss_dssp CCCCCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGGT---SSSSSCSCCC
T ss_pred CchhcCcCCCCCCCeEEECCCCCCeEeCCCCCCCeEECCCCCccccCCC---CCCCCcCCcc
Confidence 7889999999999999999999999996 24999999999999999875 7899999963
|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|