Citrus Sinensis ID: 008608


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560
MLMSVFHPWLDMSRQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPRTSPSEFIVPYDQYMESIKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWRDSKWRCLKVRWDETSTIPRPERVSLWKIEPALAPPALNSLPMPRPKRPRSNMLPSSPDSSVLTREGSSKLNVDPSSATGFSRVLQGQEFSTLRGNFAERESNESDTAEKSVVWPPSLDDEKIDVVSASRRYGSENWVPPGRHEPVYTDLLSGFGANADPSHGFSSPFADAVPVRKSVLDQEGKFNLVARPWSLMPSGPSLKMPESNAKVPVQGGDVNYQVRGNVRYGGFGDYPMLNGNRVEHSHGNWLMPPLPPSNFENSAHSRELMPKSAMVQDQEAGKSKDCKLFGIPLFSNHVMPEPVVSHRNTMNEPAGNLDQQFRAFESDQKSDHSKSSKLADDNQVFNEHEKPSQPSQTHTKDVRSKTQCGSTRSCTKVPLPH
cccccccccccccccccccEEEEEEcccccEEEEEEECcccccEEccccccccccccccccccEEEEEEcccccEEEEEEEEECccccccccccccccccccHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHcccccccEEEEEECccccccccCEEEEEEECccccccccccccEEEEEECccccccccccccccccEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECccccc
MLMSVFHPWLDMSRQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPRTSPSEFIVPYDQYMESIKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWRDSKWRCLKVRWDETSTIPRPERVSLWKIEPALA*****************************************************************************************************NWV*****EPVYTDLLSGFG**********************VLDQEGKFNLVARPW***********************DVN***RGNVRYGGFGDY**L************************************************CKLFGIPLFSN*************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLMSVFHPWLDMSRQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPRTSPSEFIVPYDQYMESIKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWRDSKWRCLKVRWDETSTIPRPERVSLWKIEPALAPPALNSLPMPRPKRPRSNMLPSSPDSSVLTREGSSKLNVDPSSATGFSRVLQGQEFSTLRGNFAERESNESDTAEKSVVWPPSLDDEKIDVVSASRRYGSENWVPPGRHEPVYTDLLSGFGANADPSHGFSSPFADAVPVRKSVLDQEGKFNLVARPWSLMPSGPSLKMPESNAKVPVQGGDVNYQVRGNVRYGGFGDYPMLNGNRVEHSHGNWLMPPLPPSNFENSAHSRELMPKSAMVQDQEAGKSKDCKLFGIPLFSNHVMPEPVVSHRNTMNEPAGNLDQQFRAFESDQKSDHSKSSKLADDNQVFNEHEKPSQPSQTHTKDVRSKTQCGSTRSCTKVPLPH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Auxin response factor 2 Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Functions independently of ethylene and cytokinin response pathways. May act as a repressor of cell division and organ growth.probableQ94JM3
Auxin response factor 4 Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).probableQ5JK20

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:very confident
Coverage over the Query: 2-86
View the alignment between query and template
View the model in PyMOL