Citrus Sinensis ID: 008622

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MKAILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYGVKRSSRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLSTPKKKMDKKFRNINTAMQFIFTIRDVKKVKRMTEEKISTCSLKALIRFISGSKLSMSNELDDQDDIKSVSEAKHLADKIIANIGSDPQSEFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFKKWVIKVYKDRETLKRSLNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEVRIRYTGPLPS
ccccHHHHHHHHHHHHHHHHHHccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccEEEEccEEEEEEEEEEEEEEEEEEcccEEEEEccccccccEEEEEccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEccccEEEEEEcccccc
cHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcHcccccccccccccccccHHHHHHHHHccccccHHHHHHHEEEEcccccccccccccccccHHHHHHHHHHHHHHHcccccccEEcHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccEEEEcccEEEEEEEEEEEEEEEcccccEEEEccHHHccccEHHcccccccHHccEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccEEEcccccccc
MKAILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDhgygvkrssraTSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLstpkkkmdKKFRNINTAMQFIFTIRDVKKVKRMTEEKISTCSLKALIRFISgsklsmsnelddqddiKSVSEAKHLADKIIAnigsdpqsefiEKDRLLEFLQNERHVKYMLKLFVGAarsgkinksdFKKWVIKVYKDRETLKRSLNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVthpfdvgdrciiDGVQMVVDEMNILTTIFLRydneriyypnsvlatkpignffrsppemgdsVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGiryyllpqevrirytgplps
MKAILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYGVKRSSRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVqvlstpkkkmdkkfRNINTAMQFIFTIRDVKKVKRMteekistcslKALIRFISGSklsmsnelddQDDIKSVSEAKHLADKIIanigsdpqseFIEKDRLLEFLQNERHVKYMLKLFVgaarsgkinksdfkkwVIKVYkdretlkrslNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLErkhkhwskdhiLVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIfedlgiryyllpqevrirytgplps
MKAILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVfiwltlvllvwillfDHGYGVKRSSRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLSTPKKKMDKKFRNINTAMQFIFTIRDVKKVKRMTEEKISTCSLKALIRFISGSKLSMSNELDDQDDIKSVSEAKHLADKIIANIGSDPQSEFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFKKWVIKVYKDRETLKRSLNDAKTAIEELNRilsaivivviiivwllvmgllTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEVRIRYTGPLPS
**AILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYGVKRSSRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLSTPKKKMDKKFRNINTAMQFIFTIRDVKKVKRMTEEKISTCSLKALIRFISG*************************DKIIANIG*****EFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFKKWVIKVYKDRETLKRSLNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEVRIRYT*****
**AILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYGVKRSSRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVL************************************************F*********************SEAKHLADKIIANIGSDPQSEFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFKKWVIKVYKDRETLKRSLNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEV**********
MKAILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYGVKRSSRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLSTPKKKMDKKFRNINTAMQFIFTIRDVKKVKRMTEEKISTCSLKALIRFISGSKLSMSNELDDQDDIKSVSEAKHLADKIIANIGSDPQSEFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFKKWVIKVYKDRETLKRSLNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEVRIRYTGPLPS
*KAILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYG****SRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLSTPKKKMD**************TIRDVKKVKRMTEEKISTCSLKALIRFISGSKLSMSNELDDQDDIKSVSEAKHLADKIIANIGSDPQSEFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFKKWVIKVYKDRETLKRSLNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEVRIRY******
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYGVKRSSRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLSTPKKKMDKKFRNINTAMQFIFTIRDVKKVKRMTEEKISTCSLKALIRFISGSKLSMSNELDDQDDIKSVSEAKHLADKIIANIGSDPQSEFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFKKWVIKVYKDxxxxxxxxxxxxxxxxxxxxxLSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEVRIRYTGPLPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query559 2.2.26 [Sep-21-2011]
Q9LYG9734 Mechanosensitive ion chan yes no 0.969 0.738 0.464 1e-143
Q84M97742 Mechanosensitive ion chan no no 0.964 0.726 0.420 1e-127
Q9LH74881 Mechanosensitive ion chan no no 0.971 0.616 0.397 1e-109
Q9SYM1856 Mechanosensitive ion chan no no 0.969 0.633 0.388 1e-109
F4IME2908 Mechanosensitive ion chan no no 0.966 0.594 0.371 1e-108
F4IME1849 Mechanosensitive ion chan no no 0.951 0.626 0.367 2e-99
Q9LPG3881 Mechanosensitive ion chan no no 0.620 0.393 0.403 2e-70
O74839 1011 Uncharacterized MscS fami yes no 0.434 0.240 0.274 3e-20
O14050 840 Uncharacterized MscS fami no no 0.384 0.255 0.226 3e-13
O28726283 Uncharacterized MscS fami yes no 0.221 0.438 0.279 0.0002
>sp|Q9LYG9|MSL10_ARATH Mechanosensitive ion channel protein 10 OS=Arabidopsis thaliana GN=MSL10 PE=1 SV=1 Back     alignment and function desciption
 Score =  508 bits (1307), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 266/573 (46%), Positives = 387/573 (67%), Gaps = 31/573 (5%)

Query: 3   AILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINI 62
           + L + E   FV I+  L++SLT+N LK+H  W LE+WKWCVL +VI  G + + WF+ +
Sbjct: 165 STLALIESAFFVVILSALVASLTINVLKHHTFWGLEVWKWCVLVMVIFSGMLVTNWFMRL 224

Query: 63  IVFLIEKNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYGVKRSSRATSKIL 122
           IVFLIE NFLL+  VLYFV+GL+ S+ VFIWL L+L+ WILLF+H   VKRS  AT K+L
Sbjct: 225 IVFLIETNFLLRRKVLYFVHGLKKSVQVFIWLCLILVAWILLFNHD--VKRSPAAT-KVL 281

Query: 123 HHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLST-P-K 180
              ITRTL   L GA  WLVKT  +K++  +F    FFDRI DS+FHQ+V+Q LS  P  
Sbjct: 282 K-CITRTLISILTGAFFWLVKTLLLKILAANFNVNNFFDRIQDSVFHQYVLQTLSGLPLM 340

Query: 181 KKMDKKFRNINTA-MQFIFTIR----------DVKKVKRMTEEKISTCSLKALIRFISGS 229
           ++ ++  R  +T  + F   ++          D+ KV +M  EK+S  +++ L+  +  S
Sbjct: 341 EEAERVGREPSTGHLSFATVVKKGTVKEKKVIDMGKVHKMKREKVSAWTMRVLMEAVRTS 400

Query: 230 KLS-MSNELDD--------QDDIKSVSEAKHLADK--IIANIGSDPQSEFIEKDRLLEFL 278
            LS +S+ LD+        Q D +  SE + LA    +  N+ + P   +IE++ LL F+
Sbjct: 401 GLSTISDTLDETAYGEGKEQADREITSEMEALAAAYHVFRNV-AQPFFNYIEEEDLLRFM 459

Query: 279 QNERHVKYMLKLFVGAARSGKINKSDFKKWVIKVYKDRETLKRSLNDAKTAIEELNRILS 338
             E  V  +  LF GAA +G+I +  F +WV+KVY  R  L  SLND KTA+++LN++++
Sbjct: 460 IKE-EVDLVFPLFDGAAETGRITRKAFTEWVVKVYTSRRALAHSLNDTKTAVKQLNKLVT 518

Query: 339 AIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVG 398
           AI++VV +++WLL++ + T K++   ++QLV LAF+ G+T +  FE+I+FVFV HP+DVG
Sbjct: 519 AILMVVTVVIWLLLLEVATTKVLLFFSTQLVALAFIIGSTCKNLFESIVFVFVMHPYDVG 578

Query: 399 DRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAI 458
           DRC++DGV M+V+EMN+LTT+FL+ +NE++YYPN+VLATKPI N+FRS P MG++VEF+I
Sbjct: 579 DRCVVDGVAMLVEEMNLLTTVFLKLNNEKVYYPNAVLATKPISNYFRS-PNMGETVEFSI 637

Query: 459 DVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYA 518
              T +  IA LK RI  YLE+  +HW+  H +VVKEIEN+NK++MALY  HTI FQ+  
Sbjct: 638 SFSTPVSKIAHLKERIAEYLEQNPQHWAPVHSVVVKEIENMNKLKMALYSDHTITFQENR 697

Query: 519 KKVKRRSKLVLELKKIFEDLGIRYYLLPQEVRI 551
           ++  RR++L L +K++ EDL I Y LLPQ++ +
Sbjct: 698 ERNLRRTELSLAIKRMLEDLHIDYTLLPQDINL 730
Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.
Arabidopsis thaliana (taxid: 3702)
>sp|Q84M97|MSL9_ARATH Mechanosensitive ion channel protein 9 OS=Arabidopsis thaliana GN=MSL9 PE=2 SV=1 Back     alignment and function description
>sp|Q9LH74|MSL5_ARATH Mechanosensitive ion channel protein 5 OS=Arabidopsis thaliana GN=MSL5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SYM1|MSL6_ARATH Mechanosensitive ion channel protein 6 OS=Arabidopsis thaliana GN=MSL6 PE=1 SV=1 Back     alignment and function description
>sp|F4IME2|MSL8_ARATH Mechanosensitive ion channel protein 8 OS=Arabidopsis thaliana GN=MSL8 PE=2 SV=2 Back     alignment and function description
>sp|F4IME1|MSL7_ARATH Mechanosensitive ion channel protein 7 OS=Arabidopsis thaliana GN=MSL7 PE=3 SV=1 Back     alignment and function description
>sp|Q9LPG3|MSL4_ARATH Mechanosensitive ion channel protein 4 OS=Arabidopsis thaliana GN=MSL4 PE=3 SV=1 Back     alignment and function description
>sp|O74839|YC1B_SCHPO Uncharacterized MscS family protein C1183.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.11 PE=1 SV=1 Back     alignment and function description
>sp|O14050|YEYH_SCHPO Uncharacterized MscS family protein C2C4.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.17c PE=3 SV=1 Back     alignment and function description
>sp|O28726|Y1546_ARCFU Uncharacterized MscS family protein AF_1546 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1546 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
225444788 772 PREDICTED: uncharacterized protein At5g1 0.971 0.703 0.554 1e-171
297738590644 unnamed protein product [Vitis vinifera] 0.971 0.843 0.554 1e-170
449452751 762 PREDICTED: mechanosensitive ion channel 0.967 0.709 0.538 1e-169
356558409 878 PREDICTED: uncharacterized protein At5g1 0.971 0.618 0.549 1e-168
224068408 684 predicted protein [Populus trichocarpa] 0.967 0.790 0.575 1e-167
356532770 789 PREDICTED: uncharacterized protein At5g1 0.973 0.689 0.536 1e-165
225444790 772 PREDICTED: uncharacterized protein At5g1 0.971 0.703 0.540 1e-162
255546009 753 conserved hypothetical protein [Ricinus 0.932 0.691 0.538 1e-159
297811331 732 mechanosensitive ion channel domain-cont 0.969 0.740 0.474 1e-147
255546013585 conserved hypothetical protein [Ricinus 0.978 0.935 0.493 1e-147
>gi|225444788|ref|XP_002278293.1| PREDICTED: uncharacterized protein At5g12080-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 318/573 (55%), Positives = 416/573 (72%), Gaps = 30/573 (5%)

Query: 9   ELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIE 68
           E I FV I+G LI+SLTV++L +  IW LE+WKW VL LVI CGR+ ++W INI+VF+IE
Sbjct: 199 EWIAFVCIMGCLIASLTVHRLLHTLIWGLEIWKWSVLVLVIFCGRLVTEWCINIVVFMIE 258

Query: 69  KNFLLKHLVLYFVYGLRTSISVFIWLTLVLLVWILLFDHGYGVKRSSRATSKILHHIITR 128
           +NFLL+  VLYFVYGL+ S+ VFIWL L+LL W LL + G  VKRS +AT +IL+++ TR
Sbjct: 259 RNFLLRKKVLYFVYGLKKSVLVFIWLGLILLAWGLLINRG--VKRSRKAT-RILNYV-TR 314

Query: 129 TLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDRIHDSIFHQHVVQVLSTPK-KKMDKKF 187
            LA  L GAA+WL KT  VK++  SF   RFFDRI +SIFHQ+V+Q LS P    M +  
Sbjct: 315 ALASCLIGAAIWLAKTLLVKILASSFHVTRFFDRIQESIFHQYVLQTLSGPPLMAMAEMV 374

Query: 188 RNINTA-MQFIFTIR----------DVKKVKRMTEEKISTCSLKALIRFISGSKLS-MSN 235
            ++N+A + F  T R          DV K+ ++ +EK+S  ++K LI+ I GS L+ +SN
Sbjct: 375 GSVNSAQLSFRSTKRGKGGEKEEVIDVGKLHKIKQEKVSAWTMKGLIQVIRGSGLTTISN 434

Query: 236 ELDDQDD----------IKSVSEAKHLADKIIANIGSDPQSEFIEKDRLLEFLQNERHVK 285
            LDD  D          I +  EA++ A +I  N+ + P ++ I+++ LL F++ E  V 
Sbjct: 435 ALDDSVDDDGGEQKDKEITNEWEARNAASRIFMNV-AKPCTKHIDEEDLLRFMKKE-EVD 492

Query: 286 YMLKLFVGAARSGKINKSDFKKWVIKVYKDRETLKRSLNDAKTAIEELNRILSAIVIVVI 345
            +L LF GA+ + KI +S  KKWV+ VY +R++L  SLND KTAIEELN+I S ++++VI
Sbjct: 493 NVLPLFEGASETRKIKRSSLKKWVVNVYLERKSLAHSLNDTKTAIEELNKIASGVMLIVI 552

Query: 346 IIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDG 405
           IIVWLL+MG  T  ++  ++SQL+L+AFMFGNT +T FEAIIFVFV HPFDVGDRC+IDG
Sbjct: 553 IIVWLLLMGFATTNVLVFISSQLLLVAFMFGNTCKTVFEAIIFVFVMHPFDVGDRCVIDG 612

Query: 406 VQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIE 465
           VQMVV+EMNILTTIFLRYDNE+I+YPNSVLATKPI NF+RS PEM DSVEFA+D  TS+E
Sbjct: 613 VQMVVEEMNILTTIFLRYDNEKIFYPNSVLATKPISNFYRS-PEMSDSVEFAVDFSTSME 671

Query: 466 IIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRS 525
            IA LK+RIK YLE K +HW   H ++VK+I +VN+M M LYVTHTINFQ+Y  K  RRS
Sbjct: 672 TIAALKARIKTYLESKPQHWRPGHSVLVKDIVDVNQMNMGLYVTHTINFQNYGDKSSRRS 731

Query: 526 KLVLELKKIFEDLGIRYYLLPQEVRIRYTGPLP 558
           +LV+ELKKIFE+L I+Y+LLPQEV +R     P
Sbjct: 732 ELVIELKKIFEELNIKYHLLPQEVHVRSVDSAP 764

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297738590|emb|CBI27835.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449452751|ref|XP_004144122.1| PREDICTED: mechanosensitive ion channel protein 10-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356558409|ref|XP_003547499.1| PREDICTED: uncharacterized protein At5g12080-like [Glycine max] Back     alignment and taxonomy information
>gi|224068408|ref|XP_002326113.1| predicted protein [Populus trichocarpa] gi|222833306|gb|EEE71783.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356532770|ref|XP_003534944.1| PREDICTED: uncharacterized protein At5g12080-like [Glycine max] Back     alignment and taxonomy information
>gi|225444790|ref|XP_002278315.1| PREDICTED: uncharacterized protein At5g12080 [Vitis vinifera] gi|297738591|emb|CBI27836.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255546009|ref|XP_002514064.1| conserved hypothetical protein [Ricinus communis] gi|223546520|gb|EEF48018.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297811331|ref|XP_002873549.1| mechanosensitive ion channel domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319386|gb|EFH49808.1| mechanosensitive ion channel domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255546013|ref|XP_002514066.1| conserved hypothetical protein [Ricinus communis] gi|223546522|gb|EEF48020.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
TAIR|locus:2143069734 MSL10 "mechanosensitive channe 0.620 0.472 0.443 4.5e-122
TAIR|locus:2180811742 MSL9 "mechanosensitive channel 0.964 0.726 0.399 1.1e-105
TAIR|locus:2099382881 MSL5 "mechanosensitive channel 0.627 0.398 0.411 5.8e-105
TAIR|locus:2202965856 MSL6 "mechanosensitive channel 0.620 0.405 0.405 1.7e-103
TAIR|locus:2024927881 MSL4 "mechanosensitive channel 0.620 0.393 0.381 1.1e-99
TAIR|locus:2827671849 AT2G17000 "AT2G17000" [Arabido 0.651 0.428 0.371 4.3e-92
DICTYBASE|DDB_G0277253870 DDB_G0277253 "mechanosensitive 0.583 0.374 0.220 9.2e-20
ASPGD|ASPL0000007479 943 AN6053 [Emericella nidulans (t 0.672 0.398 0.241 2.3e-18
POMBASE|SPCC1183.11 1011 SPCC1183.11 "MS ion channel pr 0.434 0.240 0.254 2.6e-15
UNIPROTKB|G4NH50 952 MGG_03937 "Serine/threonine pr 0.516 0.303 0.233 9.5e-15
TAIR|locus:2143069 MSL10 "mechanosensitive channel of small conductance-like 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 774 (277.5 bits), Expect = 4.5e-122, Sum P(2) = 4.5e-122
 Identities = 160/361 (44%), Positives = 234/361 (64%)

Query:   202 DVKKVKRMTEEKISTCSLKALIRFISGSKLS-MSNELDD--------QDDIKSVSEAKHL 252
             D+ KV +M  EK+S  +++ L+  +  S LS +S+ LD+        Q D +  SE + L
Sbjct:   373 DMGKVHKMKREKVSAWTMRVLMEAVRTSGLSTISDTLDETAYGEGKEQADREITSEMEAL 432

Query:   253 ADK--IIANIGSDPQSEFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFKKWVI 310
             A    +  N+ + P   +IE++ LL F+  E  V  +  LF GAA +G+I +  F +WV+
Sbjct:   433 AAAYHVFRNV-AQPFFNYIEEEDLLRFMIKEE-VDLVFPLFDGAAETGRITRKAFTEWVV 490

Query:   311 KVYKDRETLKRSLNDAKTAIEELNRXXXXXXXXXXXXXXXXXXXXXTYKIIALVTSQLVL 370
             KVY  R  L  SLND KTA+++LN+                     T K++   ++QLV 
Sbjct:   491 KVYTSRRALAHSLNDTKTAVKQLNKLVTAILMVVTVVIWLLLLEVATTKVLLFFSTQLVA 550

Query:   371 LAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYY 430
             LAF+ G+T +  FE+I+FVFV HP+DVGDRC++DGV M+V+EMN+LTT+FL+ +NE++YY
Sbjct:   551 LAFIIGSTCKNLFESIVFVFVMHPYDVGDRCVVDGVAMLVEEMNLLTTVFLKLNNEKVYY 610

Query:   431 PNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHI 490
             PN+VLATKPI N+FRSP  MG++VEF+I   T +  IA LK RI  YLE+  +HW+  H 
Sbjct:   611 PNAVLATKPISNYFRSP-NMGETVEFSISFSTPVSKIAHLKERIAEYLEQNPQHWAPVHS 669

Query:   491 LVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEVR 550
             +VVKEIEN+NK++MALY  HTI FQ+  ++  RR++L L +K++ EDL I Y LLPQ++ 
Sbjct:   670 VVVKEIENMNKLKMALYSDHTITFQENRERNLRRTELSLAIKRMLEDLHIDYTLLPQDIN 729

Query:   551 I 551
             +
Sbjct:   730 L 730
GO:0005634 "nucleus" evidence=ISM
GO:0016020 "membrane" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0008381 "mechanically-gated ion channel activity" evidence=IDA;IMP
GO:0050982 "detection of mechanical stimulus" evidence=IMP
GO:0006820 "anion transport" evidence=IDA
TAIR|locus:2180811 MSL9 "mechanosensitive channel of small conductance-like 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099382 MSL5 "mechanosensitive channel of small conductance-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202965 MSL6 "mechanosensitive channel of small conductance-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024927 MSL4 "mechanosensitive channel of small conductance-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827671 AT2G17000 "AT2G17000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277253 DDB_G0277253 "mechanosensitive ion channel domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000007479 AN6053 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPCC1183.11 SPCC1183.11 "MS ion channel protein 1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G4NH50 MGG_03937 "Serine/threonine protein kinase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016479001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (761 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
pfam00924202 pfam00924, MS_channel, Mechanosensitive ion channe 1e-12
COG0668316 COG0668, MscS, Small-conductance mechanosensitive 6e-11
>gnl|CDD|201506 pfam00924, MS_channel, Mechanosensitive ion channel Back     alignment and domain information 
 Score = 66.5 bits (163), Expect = 1e-12
 Identities = 53/214 (24%), Positives = 86/214 (40%), Gaps = 19/214 (8%)

Query: 336 ILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPF 395
           IL  ++IVV I++ L  +G+    ++A + +  + L F   +        II +F   PF
Sbjct: 1   ILKYLIIVVGILIVLSYLGVNVSALLAGLGALGLALGFALQDLVSNLVSGIIILF-EKPF 59

Query: 396 DVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPP---EMGD 452
            +GD   I  V+  V+++ I +T    +D   +  PNS + T  I N  RSP    E+  
Sbjct: 60  KIGDWIEIGDVEGTVEDIGIRSTTIRTFDGRLVTIPNSKILTSNIINLSRSPTRRVEVSI 119

Query: 453 SVEFAIDVFTSIEIIAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMAL-YVTHT 511
            V ++ D     ++I  LK          H    KD          V   E     +   
Sbjct: 120 GVAYSSDPKKLEKVIEILKEAAYE-----HPLVLKD------PEPPVVFGEFGDSSLNFE 168

Query: 512 INF---QDYAKKVKRRSKLVLELKKIFEDLGIRY 542
           +         +    RS+L L +KK  E+ GI  
Sbjct: 169 VRVWVKTLPGEYFNVRSELNLRIKKALEENGIEI 202

Two members of this protein family from M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins. Length = 202
>gnl|CDD|223740 COG0668, MscS, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 559
KOG4629714 consensus Predicted mechanosensitive ion channel [ 100.0
PRK10334286 mechanosensitive channel MscS; Provisional 100.0
PRK109291109 putative mechanosensitive channel protein; Provisi 100.0
PRK112811113 hypothetical protein; Provisional 100.0
PF00924206 MS_channel: Mechanosensitive ion channel; InterPro 100.0
COG3264835 Small-conductance mechanosensitive channel [Cell e 100.0
PRK11465741 putative mechanosensitive channel protein; Provisi 100.0
COG0668316 MscS Small-conductance mechanosensitive channel [C 99.97
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 93.11
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 92.71
cd0005267 EH Eps15 homology domain; found in proteins implic 92.13
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 91.68
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 91.6
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 91.41
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 90.9
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 90.75
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 90.31
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 90.17
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 89.48
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 87.95
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 87.63
cd0021388 S-100 S-100: S-100 domain, which represents the la 87.02
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 85.42
cd0503088 calgranulins Calgranulins: S-100 domain found in p 85.16
PRK12309391 transaldolase/EF-hand domain-containing protein; P 84.52
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 84.25
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 82.8
PTZ00184149 calmodulin; Provisional 82.43
PLN02964 644 phosphatidylserine decarboxylase 82.21
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 82.01
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 80.94
PTZ00183158 centrin; Provisional 80.89
PTZ00184149 calmodulin; Provisional 80.63
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 80.52
>KOG4629 consensus Predicted mechanosensitive ion channel [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-95  Score=803.07  Aligned_cols=540  Identities=40%  Similarity=0.724  Sum_probs=508.0

Q ss_pred             HHHHHHHHHHHHHHHHhhhcceeccccccceehhhhHHHHHHHHHHHhhhhHHhhhhheeeeeeeecccccceeeeeeec
Q 008622            4 ILIVFELILFVSIIGLLISSLTVNKLKNHAIWDLELWKWCVLALVILCGRVASQWFINIIVFLIEKNFLLKHLVLYFVYG   83 (559)
Q Consensus         4 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~lw~w~~~~~v~~~g~lv~~w~~~~~v~~ie~~f~l~~~vly~v~~   83 (559)
                      .+.+++|+.+++++.+++|+++++..++...|++..|+|++.++|.+||++++.|++.+++|++++|+++|++++|||+|
T Consensus       148 ~~~~i~~I~~~~iv~~lv~~l~i~~~~~~~~~~~~~~kw~~~~~v~~~~~lv~~~~~~~vvf~~~~n~~~r~~~l~~v~~  227 (714)
T KOG4629|consen  148 SITVITWILLVLIVSSLVCSLGIHVHRLVTLWSLILWKWLVTLLVRITAVLVSSWFAALVVFLIESNFLRRKKVLYFVYG  227 (714)
T ss_pred             cHHHHHHHHHHHHHHHHHhhhhhheecccceEEEEeeeehhhhHHHHHHHHHHhhHHHHHHHHhhhhHHHHHHHHHHHhh
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhHHHHHHHH-HHHHHHHHHHcCCCCcccCccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcchhhHHHH
Q 008622           84 LRTSISVFIWLT-LVLLVWILLFDHGYGVKRSSRATSKILHHIITRTLACFLAGAALWLVKTFSVKLIGVSFQCKRFFDR  162 (559)
Q Consensus        84 l~~~~~~~~w~~-~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~~~~~~l~~~~~v~~ia~~fh~~~~~~r  162 (559)
                      +++.+|.|+|++ +++++|+.+|+..  +++.  ...+.|.+ ++++ +|+++.+..|++|++++|++|++||++.|++|
T Consensus       228 ~~~~vq~~~~l~~lv~law~~l~d~~--v~~~--~r~~~l~~-~~~~-i~lli~~~~~lv~ti~~kv~as~f~~s~~~~r  301 (714)
T KOG4629|consen  228 LRKFVQTGIWLGKLVLLAWIFLFDKI--VFRK--TRAKFLAF-VTML-ITLLITEFMWLVKTILMKVIASSFHRSTYFSR  301 (714)
T ss_pred             hHHHHHHHHHHhHHHHHHHHHhhhhh--hhhh--hhhhhhhh-hhhh-hhhhHHHHHhhchhhhhHHHHHHHhHHHHHhh
Confidence            999999999999 9999999999987  7664  33447887 9999 99999999999999999999999999999999


Q ss_pred             HHhhhhhhHHhhhhcCCcccchhhhhcc--------CccccccccccchhhhhhhcccccchhhHHHHHHHhhcCCcc-c
Q 008622          163 IHDSIFHQHVVQVLSTPKKKMDKKFRNI--------NTAMQFIFTIRDVKKVKRMTEEKISTCSLKALIRFISGSKLS-M  233 (559)
Q Consensus       163 i~~~~~~~~~l~~L~~~~~~~~~~~~~~--------~~~~~~s~~~~~~~~l~~~~~~~~sa~~~~~~~~~v~~~~~~-~  233 (559)
                      |||++|+||+|++|++||.+|+  .|+.        +...+.....++++++|++++.++|+|+|+++++.++..+.+ +
T Consensus       302 I~e~~f~q~~l~~Lsg~p~~e~--~gr~s~~~~~~s~~~~r~~s~~i~~~~l~~~~~~~~sa~~~~~~~~~~~~~~~t~l  379 (714)
T KOG4629|consen  302 IQESVFTQEVLETLSGPPREED--VGRESTFRAIFSPGLSRSGSAKIGMDKLHKIKKKNVSAWNMRRLMTILAAGGLTTL  379 (714)
T ss_pred             cchhhhhHHHHHHhcCCccccc--ccccccceeeccccccchhhcccccchhhhhhHhhhcHhhhhHHHHHHhccCcccC
Confidence            9999999999999999987333  3332        111111112377899999999999999999999999998888 7


Q ss_pred             Cccccccc-------CCCChHHHHHHHHHHhcccccCCCccceeHhHHHhhcCChHHHHHHHHHHhhhhccccccHHHHH
Q 008622          234 SNELDDQD-------DIKSVSEAKHLADKIIANIGSDPQSEFIEKDRLLEFLQNERHVKYMLKLFVGAARSGKINKSDFK  306 (559)
Q Consensus       234 ~~~~~~~~-------~i~s~~~a~~lAr~if~~~~~~~g~~~i~~~dl~~~~~~~e~a~~af~lfd~~~~~g~Is~~~~~  306 (559)
                      +..++.+.       +++|+++|+++|++||+++++ ||..++++||+.+|+++|+ |+.++++|++..+.+ ||++.++
T Consensus       380 ~~~~~~s~~~~~~~~~i~s~~~a~~aA~~iF~nv~~-p~~~~i~ld~~~~f~~~E~-a~~~~slfe~~~~~~-Itrs~~~  456 (714)
T KOG4629|consen  380 SPGFQLSTSKDSSIIEIRSEKEAKIAARKIFKNVAK-PGVILIDLDDLLRFMGDEE-AERAFSLFEGASDEN-ITRSSFK  456 (714)
T ss_pred             CccccccccccchhhhhhhhhhHHHHHHHHHhccCC-CCccchhhhhhhhcCCHHH-HHHHHHhhhhhcccC-ccHHHHH
Confidence            66665543       599999999999999999999 9999999999999999888 999999999985555 9999999


Q ss_pred             HHHHHHHHhhHHHHhhccChhHHHHHHHHHHHHHHHHHHHHHHHHHhCchhHHHHHHHHHHHHHHHHHhhhhHhHHHHHH
Q 008622          307 KWVIKVYKDRETLKRSLNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAI  386 (559)
Q Consensus       307 ~~v~~i~~eRk~l~~sl~d~~t~v~~L~~il~~iv~ii~iii~L~ilgi~~~~lla~~g~~~lal~fa~q~tl~n~f~s~  386 (559)
                      +|++++|+||++|+++++|+++++++|++++.+++.++++++++..+|++++++++..+++.++++|+|+++++++++|+
T Consensus       457 ~~iv~~~~ERk~L~~tL~d~~taV~kL~~il~~Iv~vv~~~i~lil~~i~~~~~l~~~~sq~v~l~fif~~~~k~~~esi  536 (714)
T KOG4629|consen  457 EWIVNIYRERKALARTLNDTKTAVNKLDRILNFIVAVVLLVIWLILLGINTSKLLLVISSQLVGLAFIFGNIVKELLESI  536 (714)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccceeeeeeecccceeeeeehhhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCcCCCCEEEECCeEEEEEEEeeEEEEEEecCCcEEEEeCCcccCCcEEeccCCCCceeEEEEEEEecCCCHHH
Q 008622          387 IFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEI  466 (559)
Q Consensus       387 IfIfv~~PFdVGDrI~I~g~~g~VeeI~Ll~T~f~~~dg~~V~IPNs~L~s~~I~N~sRs~~~~~~~i~~~V~~~t~~ek  466 (559)
                      ||+|+.|||||||||.|||+++.|+||||++|+|.++||+++++|||.|++++|.|++||| .|.+.+++.++..|+++|
T Consensus       537 IFlfv~HPyDvGDRv~VDg~~~vVeemnLlsTvF~~~dg~kI~~PNS~L~~k~I~N~rRS~-~~~~~v~f~i~~~T~~~K  615 (714)
T KOG4629|consen  537 IFLFVMHPYDVGDRVVVDGVNLVVEEMNLLSTVFLRVDGRKIFIPNSVLWTKAISNYRRSP-DMGDEVEFLISSSTPFEK  615 (714)
T ss_pred             hheeecCCCCCCCeEEEeceEEEEEEeccceEEEEEECCeEEEeecHHHHhhhhhhhhcCc-cccccEEEEecCCCCHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999 999999999999999999


Q ss_pred             HHHHHHHHHHHHhhccCCcCCCcEEEEEEEcCCceEEEEEEEEEeccccChhhHHHHHHHHHHHHHHHHHHCCCcccCCc
Q 008622          467 IAELKSRIKHYLERKHKHWSKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLP  546 (559)
Q Consensus       467 I~~lk~~i~~~v~~~p~~~~p~~~v~v~~i~d~~~l~l~v~v~~~~n~q~~~~~~~~rs~l~~~I~~~l~e~gI~~~~P~  546 (559)
                      ++.+|++|.+|++++|++|.|++.+.+.+++|.|++.+.++++|++||||..+++.||.++++++.+.++|+||+|.++|
T Consensus       616 i~~Lk~rI~~ylks~~~~~~p~~~~~i~~~e~~n~v~i~v~~~h~~n~Qd~~~~~~Rr~~~~~~l~~~~~eLdI~y~l~p  695 (714)
T KOG4629|consen  616 IERLKERIAEYLKSSPDDYYPDLMVVIEEIEDLNSVKICVVVQHKINFQDMKERWSRRTEFVSALTKIMRELDIEYTLYP  695 (714)
T ss_pred             HHHHHHHHHHHHhcCccccccchhhHHHhhhhcCcceEEEEEEeecchhhHHHHHhhHHHHHHHHHHHHHHcCcceeecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEecCC
Q 008622          547 QEVRIRYTG  555 (559)
Q Consensus       547 ~~V~l~~~~  555 (559)
                      +++++.+.+
T Consensus       696 ~~in~~~~~  704 (714)
T KOG4629|consen  696 LDINLKNLP  704 (714)
T ss_pred             cchhhhcCC
Confidence            999999876

>PRK10334 mechanosensitive channel MscS; Provisional Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF00924 MS_channel: Mechanosensitive ion channel; InterPro: IPR006685 Mechanosensitive (MS) channels provide protection against hypo-osmotic shock, responding both to stretching of the cell membrane and to membrane depolarisation Back     alignment and domain information
>COG3264 Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11465 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>COG0668 MscS Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
2vv5_A286 MSCS, small-conductance mechanosensitive channel; 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>2vv5_A MSCS, small-conductance mechanosensitive channel; ION transport, transmembrane, inner membrane, membrane struc membrane protein, membrane; 3.45A {Escherichia coli} SCOP: b.38.1.3 d.58.43.1 f.34.1.1 PDB: 2oau_A Length = 286 Back     alignment and structure
 Score = 64.7 bits (158), Expect = 1e-11
 Identities = 28/143 (19%), Positives = 59/143 (41%), Gaps = 4/143 (2%)

Query: 307 KWVIKVYKD--RETLKRSLNDAKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALV 364
             + ++  +     +     D  T  + L+ ++   +I   +I  L  +G+ T  +IA++
Sbjct: 42  LIIARMISNAVNRLMISRKID-ATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVL 100

Query: 365 TSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYD 424
            +  +++      +  +   A + + +  PF  G+   + GV   V  + I +T     D
Sbjct: 101 GAAGLVVGLALQGSL-SNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTAD 159

Query: 425 NERIYYPNSVLATKPIGNFFRSP 447
            + I  PN  +    I NF R P
Sbjct: 160 GKIIVIPNGKIIAGNIINFSREP 182
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
2vv5_A286 MSCS, small-conductance mechanosensitive channel; 100.0
3udc_A285 Small-conductance mechanosensitive channel, C-TER 100.0
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 94.81
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 94.23
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 94.19
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 93.94
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 93.83
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 93.46
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 93.34
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 93.19
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 93.16
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 93.12
3akb_A166 Putative calcium binding protein; EF-hand, metal b 93.11
1avs_A90 Troponin C; muscle contraction, calcium-activated, 93.08
3li6_A66 Calcium-binding protein; calcium signaling protein 93.06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 92.95
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 92.9
1qjt_A99 EH1, epidermal growth factor receptor substrate su 92.87
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 92.86
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 92.71
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 92.69
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 92.55
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 92.52
3a4u_B143 Multiple coagulation factor deficiency protein 2; 92.11
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 92.11
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 92.06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 91.89
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 91.86
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 91.83
1c07_A95 Protein (epidermal growth factor receptor pathway 91.82
2lv7_A100 Calcium-binding protein 7; metal binding protein; 91.8
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 91.68
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 91.63
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 91.59
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 91.51
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 91.47
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 91.43
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 91.41
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 91.37
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 91.35
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 91.23
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 91.09
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 91.04
2jnf_A158 Troponin C; stretch activated muscle contraction, 91.01
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 91.01
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 90.91
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 90.89
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 90.85
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 90.79
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 90.75
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 90.69
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 90.66
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 90.64
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 90.58
3fwb_A161 Cell division control protein 31; gene gating, com 90.47
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 90.45
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 90.43
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 90.41
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 90.31
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 90.29
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 90.29
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 90.17
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 90.17
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 90.16
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 90.15
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 90.06
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 90.05
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 90.03
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 89.99
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 89.93
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 89.9
3fwb_A161 Cell division control protein 31; gene gating, com 89.86
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 89.8
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 89.67
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 89.63
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 89.62
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 89.58
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 89.58
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 89.54
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 89.52
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 89.51
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 89.49
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 89.48
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 89.47
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 89.43
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 89.38
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 89.37
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 89.37
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 89.35
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 89.31
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 89.21
1y1x_A191 Leishmania major homolog of programmed cell death 89.17
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 89.12
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 89.11
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 89.06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 88.95
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 88.89
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 88.87
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 88.86
1y1x_A191 Leishmania major homolog of programmed cell death 88.85
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 88.72
2hps_A186 Coelenterazine-binding protein with bound coelent; 88.72
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 88.49
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 88.48
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 88.44
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 88.43
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 88.41
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 88.41
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 88.33
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 88.33
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 88.33
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 88.31
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 88.28
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 88.28
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 88.27
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 88.02
1exr_A148 Calmodulin; high resolution, disorder, metal trans 87.99
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 87.95
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 87.93
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 87.87
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 87.7
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 87.56
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 87.55
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 87.55
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 87.53
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 87.52
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 87.45
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 87.35
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 87.31
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 87.15
3akb_A166 Putative calcium binding protein; EF-hand, metal b 87.03
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 87.01
2jq6_A139 EH domain-containing protein 1; metal binding prot 86.9
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 86.89
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 86.8
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 86.78
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 86.77
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 86.68
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 86.64
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 86.64
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 86.62
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 86.6
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 86.59
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 86.51
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 86.5
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 86.39
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 86.29
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 86.27
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 86.25
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 86.25
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 86.19
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 86.14
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 85.96
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 85.95
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 85.91
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 85.89
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 85.86
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 85.8
2jnf_A158 Troponin C; stretch activated muscle contraction, 85.65
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 85.59
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 85.58
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 85.54
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 85.54
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 85.21
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 85.17
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 85.11
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 85.06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 84.99
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 84.89
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 84.79
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 84.71
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 84.67
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 84.64
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 84.42
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 84.37
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 84.36
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 84.34
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 84.23
3lij_A494 Calcium/calmodulin dependent protein kinase with A 83.79
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 83.75
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 83.7
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 83.62
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 83.61
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 83.59
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 83.57
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 83.45
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 83.26
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 83.05
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 82.99
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 82.87
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 82.81
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 82.67
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 82.56
3lij_A494 Calcium/calmodulin dependent protein kinase with A 82.38
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 82.29
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 82.23
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 82.1
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 82.06
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 81.74
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 81.74
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 81.71
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 81.57
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 81.48
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 81.23
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 81.17
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 81.0
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 80.87
>2vv5_A MSCS, small-conductance mechanosensitive channel; ION transport, transmembrane, inner membrane, membrane struc membrane protein, membrane; 3.45A {Escherichia coli} SCOP: b.38.1.3 d.58.43.1 f.34.1.1 PDB: 2oau_A Back     alignment and structure
Probab=100.00  E-value=5.2e-39  Score=328.25  Aligned_cols=221  Identities=16%  Similarity=0.239  Sum_probs=201.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHhCchhHHHHHHHHHHHHHHHHHhhhhHhHHHHHHHHHhhcCCcCCCCEEEECC
Q 008622          326 AKTAIEELNRILSAIVIVVIIIVWLLVMGLLTYKIIALVTSQLVLLAFMFGNTARTCFEAIIFVFVTHPFDVGDRCIIDG  405 (559)
Q Consensus       326 ~~t~v~~L~~il~~iv~ii~iii~L~ilgi~~~~lla~~g~~~lal~fa~q~tl~n~f~s~IfIfv~~PFdVGDrI~I~g  405 (559)
                      .++..+.+.++++++++++++++++..+|++++++++++|++++++||++|++++|+++| ++++++|||++||+|+++|
T Consensus        62 ~~~~~~~~~~i~~~~i~~i~~~~~l~~~gi~~~~l~a~~g~~g~aig~a~q~~l~n~~sG-i~i~~~~pf~vGD~I~i~g  140 (286)
T 2vv5_A           62 DATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLVVGLALQGSLSNLAAG-VLLVMFRPFRAGEYVDLGG  140 (286)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSTTHHHHHHHHHHHHHHHHTHHHHHHHHH-HHHHTTCSSCTTCEEESSS
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhh-hHHHhcCCccCCCEEEECC
Confidence            467889999999999999999999999999999999999999999999999999997765 5799999999999999999


Q ss_pred             eEEEEEEEeeEEEEEEecCCcEEEEeCCcccCCcEEeccCCCCceeEEEEEEEecCCCHHHHHHHHHHHHHHHhhccCCc
Q 008622          406 VQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFFRSPPEMGDSVEFAIDVFTSIEIIAELKSRIKHYLERKHKHW  485 (559)
Q Consensus       406 ~~g~VeeI~Ll~T~f~~~dg~~V~IPNs~L~s~~I~N~sRs~~~~~~~i~~~V~~~t~~ekI~~lk~~i~~~v~~~p~~~  485 (559)
                      ..|+|++|++++|++++.||+.++|||+.+.+++|.|+||++ .++..+++.++|++|+++   +++.+++.++++|+..
T Consensus       141 ~~G~V~~I~l~~T~i~t~dg~~v~IPNs~l~~~~i~N~s~~~-~~r~~~~v~v~y~~d~~~---v~~~l~~~~~~~~~vl  216 (286)
T 2vv5_A          141 VAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREP-VRRNEFIIGVAYDSDIDQ---VKQILTNIIQSEDRIL  216 (286)
T ss_dssp             CEEEEEEECSSEEEEECTTSCEEEEEHHHHHTSCEEESSSSS-EEEEEEEEEECTTSCHHH---HHHHHHHHHHHCTTBC
T ss_pred             EEEEEEEEEeEEEEEEeCCCCEEEechHHHhhCceEECCCCC-cEEEEEEEEEcCCCCHHH---HHHHHHHHHHhCcccc
Confidence            999999999999999999999999999999999999999998 888999999999999555   8899999999999986


Q ss_pred             -CCCcEEEEEEEcCCceEEEEEEEEEeccccChhhHHHHHHHHHHHHHHHHHHCCCcccCCceEEEEecCCCC
Q 008622          486 -SKDHILVVKEIENVNKMEMALYVTHTINFQDYAKKVKRRSKLVLELKKIFEDLGIRYYLLPQEVRIRYTGPL  557 (559)
Q Consensus       486 -~p~~~v~v~~i~d~~~l~l~v~v~~~~n~q~~~~~~~~rs~l~~~I~~~l~e~gI~~~~P~~~V~l~~~~~~  557 (559)
                       +|.|.+.+.+++|+ ++++++.++.+     ..+++..|++++++++++|+++||++|+|++++++.+.+++
T Consensus       217 ~~p~p~v~v~~~~~~-~i~~~v~~~~~-----~~~~~~~~~~l~~~i~~~~~~~gI~ip~P~~~v~~~~~~~~  283 (286)
T 2vv5_A          217 KDREMTVRLNELGAS-SINFVVRVWSN-----SGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKED  283 (286)
T ss_dssp             TTSCEEEEEEEECSS-SEEEEEEEEEE-----TTTHHHHHHHHHHHHHHHHHHHTCCCCCCEEEEEEECC---
T ss_pred             cCCCCEEEEEEecCC-eEEEEEEEEEc-----cchHHHHHHHHHHHHHHHHHHCCCcCCCCceEEEeccCCcc
Confidence             68899999999986 67766666553     25678999999999999999999999999999999886544
>3udc_A Small-conductance mechanosensitive channel, C-TER peptide from small-conductance...; membrane protein; 3.35A {Thermoanaerobacter tengcongensis} PDB: 3t9n_A* Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 559
d2vv5a167 b.38.1.3 (A:113-179) Mechanosensitive channel prot 3e-12
>d2vv5a1 b.38.1.3 (A:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]} Length = 67 Back     information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Mechanosensitive channel protein MscS (YggB), middle domain
domain: Mechanosensitive channel protein MscS (YggB), middle domain
species: Escherichia coli [TaxId: 562]

 Score = 59.7 bits (145), Expect = 3e-12
 Identities = 16/61 (26%), Positives = 25/61 (40%)

Query: 383 FEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGN 442
             A + + +  PF  G+   + GV   V  + I +T     D + I  PN  +    I N
Sbjct: 6   LAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIIN 65

Query: 443 F 443
           F
Sbjct: 66  F 66

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
d2vv5a167 Mechanosensitive channel protein MscS (YggB), midd 99.74
d2vv5a2101 Mechanosensitive channel protein MscS (YggB), C-te 99.42
d2vv5a386 Mechanosensitive channel protein MscS (YggB), tran 97.95
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 96.25
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 95.78
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.17
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 95.12
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 94.82
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 94.66
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 94.07
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 93.99
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.45
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 93.45
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 93.45
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.39
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 93.38
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 93.22
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 93.07
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 92.9
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 92.85
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 92.76
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 92.58
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 92.36
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 92.36
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 92.22
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 92.01
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 91.84
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 91.8
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.42
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 91.12
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 90.98
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 90.67
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 90.67
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 90.63
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 90.57
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 90.53
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 90.45
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 90.44
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 90.36
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 90.34
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 90.28
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 90.23
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 90.15
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 89.58
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 89.55
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 89.45
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 89.36
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 89.02
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 88.56
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 88.38
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 88.29
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 88.21
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 88.09
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 88.04
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 87.82
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 87.65
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 87.33
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 87.23
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 87.1
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 86.98
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 86.91
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 86.2
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 85.16
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 84.91
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 84.88
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 84.32
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 83.9
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 83.59
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 83.06
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 82.45
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 82.43
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 82.31
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 82.1
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 81.85
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 81.74
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 81.29
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 81.11
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 80.79
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 80.61
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 80.22
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 80.21
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 80.06
>d2vv5a1 b.38.1.3 (A:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Mechanosensitive channel protein MscS (YggB), middle domain
domain: Mechanosensitive channel protein MscS (YggB), middle domain
species: Escherichia coli [TaxId: 562]

Probab=99.74  E-value=7e-19  Score=138.60  Aligned_cols=67  Identities=22%  Similarity=0.323  Sum_probs=63.1

Q ss_pred             hhHhHHHHHHHHHhhcCCcCCCCEEEECCeEEEEEEEeeEEEEEEecCCcEEEEeCCcccCCcEEecc
Q 008622          377 NTARTCFEAIIFVFVTHPFDVGDRCIIDGVQMVVDEMNILTTIFLRYDNERIYYPNSVLATKPIGNFF  444 (559)
Q Consensus       377 ~tl~n~f~s~IfIfv~~PFdVGDrI~I~g~~g~VeeI~Ll~T~f~~~dg~~V~IPNs~L~s~~I~N~s  444 (559)
                      ++++|+++|+ +++++|||++||+|+++|..|+|+||+|++|++++.||+.+++||+.+.+++|.|||
T Consensus         1 GtlsN~~sGi-~i~~~~pf~vGD~I~i~~~~G~V~~I~l~~T~l~~~dg~~i~iPN~~~~~~~i~N~S   67 (67)
T d2vv5a1           1 GSLSNLAAGV-LLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFS   67 (67)
T ss_dssp             HHHHHHHHHH-HHHTTCSSCTTCEEESSSCEEEEEEECSSEEEEECTTSCEEEEEHHHHHTSCEEESS
T ss_pred             CcHHHHHHHh-hheeeCCccCCCEEEECCEEEEEEEEeceEEEEEccCCCEEEEECHHHcCCccEECc
Confidence            4789977665 699999999999999999999999999999999999999999999999999999986
>d2vv5a2 d.58.43.1 (A:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vv5a3 f.34.1.1 (A:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure