Citrus Sinensis ID: 008671

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------

MGSTGEPDRKRRHFSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQNQKLVQKLETQKVEYSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRFVNLLEYYYL

ccccccccHHcccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccccHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcc

****************************************AVLQFQNQKLVQKLE**KVEYSAL****************TLKVVNKSWEELITDL*******************************************************************KNIVSNILAAVDNLWHLKGGLYAAVLKDL*********************LALMDL***********************************VKELEECNCKLAALRAERDVTK*AFF**************************************QLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQL***KSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQ************************IIAEFRALV***************KYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRFVNLLEYYYL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGSTGEPDRKRRHFSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQxxxxxxxxxxxxxxxxxxxxxxxxxxxxQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDVTKGAFFPVLNLGNKHVAGDRxxxxxxxxxxxxxxxxxxxxxASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIExxxxxxxxxxxxxxxxxxxxxPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRFVNLLEYYYL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase BRE1-like 1	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6. Required for the regulation of flowering time and defense against necrotrophic fungal pathogens.	probable	Q8RXD6

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 355-512
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 319-343,356-438
View the alignment between query and template
View the model in PyMOL

Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 211-269
View the alignment between query and template
View the model in PyMOL