Citrus Sinensis ID: 008733
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 555 | ||||||
| 224122978 | 831 | predicted protein [Populus trichocarpa] | 0.911 | 0.608 | 0.575 | 1e-169 | |
| 359493727 | 1767 | PREDICTED: uncharacterized protein LOC10 | 0.900 | 0.282 | 0.540 | 1e-164 | |
| 359493717 | 641 | PREDICTED: G-type lectin S-receptor-like | 0.902 | 0.781 | 0.537 | 1e-163 | |
| 147821366 | 1391 | hypothetical protein VITISV_000007 [Viti | 0.899 | 0.358 | 0.543 | 1e-162 | |
| 302143151 | 817 | unnamed protein product [Vitis vinifera] | 0.906 | 0.615 | 0.537 | 1e-160 | |
| 255569631 | 868 | S-locus-specific glycoprotein S13 precur | 0.899 | 0.574 | 0.538 | 1e-160 | |
| 359493725 | 1593 | PREDICTED: uncharacterized protein LOC10 | 0.906 | 0.315 | 0.536 | 1e-160 | |
| 224122958 | 812 | predicted protein [Populus trichocarpa] | 0.929 | 0.635 | 0.531 | 1e-160 | |
| 359493740 | 2422 | PREDICTED: uncharacterized protein LOC10 | 0.873 | 0.200 | 0.540 | 1e-159 | |
| 147799241 | 818 | hypothetical protein VITISV_027305 [Viti | 0.900 | 0.611 | 0.539 | 1e-159 |
| >gi|224122978|ref|XP_002330411.1| predicted protein [Populus trichocarpa] gi|222871796|gb|EEF08927.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 603 bits (1554), Expect = e-169, Method: Compositional matrix adjust.
Identities = 306/532 (57%), Positives = 388/532 (72%), Gaps = 26/532 (4%)
Query: 23 MEGFNLLIIYSFLFYIISAAR-TLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRY 81
+ GF +L +++FL +ISA R + DT++ GQSI+DG+ LVSA SFELGFFSPG SK RY
Sbjct: 5 ISGFIILFVHTFL--LISAIRASTDTLTPGQSIRDGDLLVSADGSFELGFFSPGISKGRY 62
Query: 82 LGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQ 141
LGIWY+KI+ GTV WVANR+ PL+D SG L + + GIL+LLNS+ D +WSSN+S +AQ
Sbjct: 63 LGIWYQKISAGTVVWVANRETPLNDSSGALIVTDQ--GILILLNSSKDAIWSSNASRTAQ 120
Query: 142 KPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKS 201
PV L++SGNLVVKD DN+ +N LWQSFDYP DTLLPGMK G N+ TGL+R+LSSWKS
Sbjct: 121 NPVMKLLDSGNLVVKDINDNS-ENFLWQSFDYPGDTLLPGMKWGRNMVTGLDRYLSSWKS 179
Query: 202 TDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSN 261
++DPA+G+FT+ +DPRG Q++L + I +R G+WNG WTG PQL+ N +YT+ ++S
Sbjct: 180 SNDPAQGEFTFRIDPRGNTQMLLMRGPKILYRTGTWNGYRWTGTPQLEPNMLYTYGFIST 239
Query: 262 EKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCG 321
E +Y ++L NSSV SR+V+N +G QR+TW+ RT +W +RFS V LDQCD YALCG
Sbjct: 240 ATEMYYKFDLINSSVASRIVMNSSGAAQRFTWITRTNSW---ARFSAVLLDQCDDYALCG 296
Query: 322 AYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLP 381
AY SCN+N P C CL+GF+P S ++W +Q S GCVRRT LDC GD FL+H VKLP
Sbjct: 297 AYGSCNVNKQ-PVCACLEGFIPKSPKDWSIQEWSDGCVRRTKLDCDKGDRFLQHGGVKLP 355
Query: 382 DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD 441
D SWVD + L ECK+LC KNCSC AYAN+D+RG GSGCLLWF +LID +EL GQD
Sbjct: 356 DMIKSWVDTSKGLKECKDLCLKNCSCVAYANSDIRGGGSGCLLWFDELIDTRELTTGGQD 415
Query: 442 LFIRMAASELDNVERRRQSKNKKQVMIIITSISLATAVIFIGGLMY-RRKKHSNQGN--- 497
L+IR+AASEL N+E+ R S +KKQ+ II+ +I V+ + ++Y RRKK Q N
Sbjct: 416 LYIRIAASELYNIEKNRSS-DKKQLGIIVGTIITIVGVLVLAFILYARRKKLKKQANMKT 474
Query: 498 -----------EKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKVTL 538
KE+MELP FDL IANATDNFS +NKLGEGGFG VYK TL
Sbjct: 475 SHLQNYEDEDQRKEDMELPTFDLSTIANATDNFSSRNKLGEGGFGSVYKGTL 526
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359493727|ref|XP_002280656.2| PREDICTED: uncharacterized protein LOC100243545 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493717|ref|XP_002280926.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147821366|emb|CAN70182.1| hypothetical protein VITISV_000007 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302143151|emb|CBI20446.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255569631|ref|XP_002525781.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus communis] gi|223534931|gb|EEF36617.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359493725|ref|XP_002280679.2| PREDICTED: uncharacterized protein LOC100260657 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224122958|ref|XP_002330406.1| predicted protein [Populus trichocarpa] gi|222871791|gb|EEF08922.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359493740|ref|XP_002280379.2| PREDICTED: uncharacterized protein LOC100262430 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147799241|emb|CAN77004.1| hypothetical protein VITISV_027305 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 555 | ||||||
| TAIR|locus:2131684 | 783 | AT4G27290 [Arabidopsis thalian | 0.749 | 0.531 | 0.516 | 3.5e-137 | |
| TAIR|locus:2141181 | 850 | RK3 "receptor kinase 3" [Arabi | 0.778 | 0.508 | 0.426 | 5.5e-113 | |
| TAIR|locus:2018546 | 843 | RK1 "receptor kinase 1" [Arabi | 0.772 | 0.508 | 0.401 | 1.7e-103 | |
| TAIR|locus:2131694 | 815 | AT4G27300 [Arabidopsis thalian | 0.857 | 0.584 | 0.431 | 1.1e-101 | |
| TAIR|locus:2018506 | 847 | RK2 "receptor kinase 2" [Arabi | 0.772 | 0.506 | 0.405 | 4.7e-99 | |
| TAIR|locus:2141176 | 849 | B120 [Arabidopsis thaliana (ta | 0.807 | 0.527 | 0.365 | 1.7e-86 | |
| TAIR|locus:2200908 | 842 | AT1G61610 [Arabidopsis thalian | 0.711 | 0.469 | 0.372 | 2.2e-84 | |
| TAIR|locus:2059103 | 828 | AT2G19130 [Arabidopsis thalian | 0.861 | 0.577 | 0.371 | 2.7e-84 | |
| TAIR|locus:2200151 | 830 | SD1-13 "S-domain-1 13" [Arabid | 0.794 | 0.531 | 0.343 | 2.2e-80 | |
| TAIR|locus:2088619 | 439 | AT3G12000 [Arabidopsis thalian | 0.668 | 0.845 | 0.419 | 2.7e-77 |
| TAIR|locus:2131684 AT4G27290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1220 (434.5 bits), Expect = 3.5e-137, Sum P(2) = 3.5e-137
Identities = 223/432 (51%), Positives = 306/432 (70%)
Query: 42 ARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRD 101
A+ D + Q++KDG+T+VS SFE+GFFSPG S++RYLGIWYKKI+ TV WVANRD
Sbjct: 21 AQATDILIANQTLKDGDTIVSQGGSFEVGFFSPGGSRNRYLGIWYKKISLQTVVWVANRD 80
Query: 102 APLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQK-----PVAALMESGNLVVK 156
+PL D SG L+++ NG L L N N +WSS+SS S+QK P+ ++++GNLVV+
Sbjct: 81 SPLYDLSGTLKVS--ENGSLCLFNDRNHIIWSSSSSPSSQKASLRNPIVQILDTGNLVVR 138
Query: 157 DGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDP 216
+ D+ + +WQS DYP D LPGMK G+N TGLNRFL+SW++ DDP+ G++T +DP
Sbjct: 139 NSGDDQ--DYIWQSLDYPGDMFLPGMKYGLNFVTGLNRFLTSWRAIDDPSTGNYTNKMDP 196
Query: 217 RGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSV 276
G+PQ L+KNS++ FR G WNGL +TG+P L+ NP+Y +EYV E+E +YTY L N SV
Sbjct: 197 NGVPQFFLKKNSVVVFRTGPWNGLRFTGMPNLKPNPIYRYEYVFTEEEVYYTYKLENPSV 256
Query: 277 PSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECE 336
+RM +NP G +QRYTW++ ++W + S + +D CD Y LCG+Y SCNIN SP C
Sbjct: 257 LTRMQLNPNGALQRYTWVDNLQSWNFY--LSAM-MDSCDQYTLCGSYGSCNINE-SPACR 312
Query: 337 CLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHG-DGFLEHKAVKLPDTRFSWVDKNITLW 395
CL+GFV + + W S GCVRR LDC G DGFL+ +KLPDTR SW DKN+ L
Sbjct: 313 CLKGFVAKTPQAWVAGDWSEGCVRRVKLDCGKGEDGFLKISKLKLPDTRTSWYDKNMDLN 372
Query: 396 ECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMAASELDNVE 455
ECK++C +NC+C+AY+ D+R G GC+LWF DLIDI+E E+GQDL++R+A+SE++ ++
Sbjct: 373 ECKKVCLRNCTCSAYSPFDIRDGGKGCILWFGDLIDIREYNENGQDLYVRLASSEIETLQ 432
Query: 456 RR--RQSKNKKQ 465
R R S K++
Sbjct: 433 RESSRVSSRKQE 444
|
|
| TAIR|locus:2141181 RK3 "receptor kinase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018546 RK1 "receptor kinase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131694 AT4G27300 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018506 RK2 "receptor kinase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141176 B120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200908 AT1G61610 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059103 AT2G19130 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200151 SD1-13 "S-domain-1 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2088619 AT3G12000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 555 | |||
| pfam01453 | 109 | pfam01453, B_lectin, D-mannose binding lectin | 5e-37 | |
| pfam00954 | 110 | pfam00954, S_locus_glycop, S-locus glycoprotein fa | 7e-37 | |
| cd00028 | 116 | cd00028, B_lectin, Bulb-type mannose-specific lect | 8e-34 | |
| smart00108 | 114 | smart00108, B_lectin, Bulb-type mannose-specific l | 9e-31 | |
| pfam08276 | 66 | pfam08276, PAN_2, PAN-like domain | 9e-29 | |
| cd01098 | 84 | cd01098, PAN_AP_plant, Plant PAN/APPLE-like domain | 5e-23 | |
| smart00473 | 78 | smart00473, PAN_AP, divergent subfamily of APPLE d | 2e-09 | |
| cd00129 | 80 | cd00129, PAN_APPLE, PAN/APPLE-like domain; present | 1e-05 |
| >gnl|CDD|216511 pfam01453, B_lectin, D-mannose binding lectin | Back alignment and domain information |
|---|
Score = 132 bits (334), Expect = 5e-37
Identities = 56/116 (48%), Positives = 69/116 (59%), Gaps = 7/116 (6%)
Query: 91 EGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAALMES 150
TV WVANR PL+D S L + +G LVL + VWSSN+S VA L +
Sbjct: 1 NQTVVWVANRLNPLTDSSYTLILQS--DGNLVLYDGNGRVVWSSNTSGKGSGCVAVLQDD 58
Query: 151 GNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPA 206
GNLV+ D N +LWQSFD+P DTLLPG K G N+ G +R L+SWKS DP+
Sbjct: 59 GNLVLYD----NSGKVLWQSFDHPTDTLLPGQKDG-NVVIGGSRRLTSWKSNTDPS 109
|
These proteins include mannose-specific lectins from plants as well as bacteriocins from bacteria. Length = 109 |
| >gnl|CDD|201524 pfam00954, S_locus_glycop, S-locus glycoprotein family | Back alignment and domain information |
|---|
| >gnl|CDD|237995 cd00028, B_lectin, Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >gnl|CDD|214519 smart00108, B_lectin, Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >gnl|CDD|219774 pfam08276, PAN_2, PAN-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238531 cd01098, PAN_AP_plant, Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins | Back alignment and domain information |
|---|
| >gnl|CDD|214680 smart00473, PAN_AP, divergent subfamily of APPLE domains | Back alignment and domain information |
|---|
| >gnl|CDD|238074 cd00129, PAN_APPLE, PAN/APPLE-like domain; present in N-terminal (N) domains of plasminogen/ hepatocyte growth factor proteins, plasma prekallikrein/coagulation factor XI and microneme antigen proteins, plant receptor-like protein kinases, and various nematode and leech anti-platelet proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 555 | |||
| PF01453 | 114 | B_lectin: D-mannose binding lectin; InterPro: IPR0 | 99.95 | |
| PF00954 | 110 | S_locus_glycop: S-locus glycoprotein family; Inter | 99.94 | |
| cd00028 | 116 | B_lectin Bulb-type mannose-specific lectin. The do | 99.93 | |
| smart00108 | 114 | B_lectin Bulb-type mannose-specific lectin. | 99.91 | |
| PF08276 | 66 | PAN_2: PAN-like domain; InterPro: IPR013227 PAN do | 99.55 | |
| cd01098 | 84 | PAN_AP_plant Plant PAN/APPLE-like domain; present | 99.38 | |
| cd00129 | 80 | PAN_APPLE PAN/APPLE-like domain; present in N-term | 99.29 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 98.86 | |
| smart00108 | 114 | B_lectin Bulb-type mannose-specific lectin. | 98.81 | |
| cd00028 | 116 | B_lectin Bulb-type mannose-specific lectin. The do | 98.76 | |
| PF01453 | 114 | B_lectin: D-mannose binding lectin; InterPro: IPR0 | 98.48 | |
| smart00473 | 78 | PAN_AP divergent subfamily of APPLE domains. Apple | 98.35 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.05 | |
| cd01100 | 73 | APPLE_Factor_XI_like Subfamily of PAN/APPLE-like d | 97.02 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 96.78 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 96.32 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 95.59 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 95.5 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 94.99 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 94.33 | |
| PTZ00284 | 467 | protein kinase; Provisional | 93.63 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 92.25 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 91.4 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 91.05 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 90.99 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 90.92 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 90.49 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 90.38 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 90.34 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 90.18 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 89.79 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 89.49 | |
| smart00090 | 237 | RIO RIO-like kinase. | 89.37 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 89.09 | |
| PF00024 | 79 | PAN_1: PAN domain This Prosite entry concerns appl | 89.0 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 88.98 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 88.79 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 88.64 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 88.51 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 88.34 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 88.22 | |
| smart00223 | 79 | APPLE APPLE domain. Four-fold repeat in plasma kal | 88.01 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 87.65 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 86.98 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 86.52 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 86.33 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 86.27 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 86.09 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 85.61 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 85.6 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 85.26 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 84.29 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 84.26 | |
| PF14295 | 51 | PAN_4: PAN domain; PDB: 2YIL_E 2YIP_C 2YIO_A. | 83.95 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 83.56 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 83.4 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 82.66 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 82.48 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 82.34 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 82.16 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 81.46 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 81.34 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 81.34 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 81.19 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 80.12 |
| >PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity | Back alignment and domain information |
|---|
Probab=99.95 E-value=2.3e-29 Score=221.03 Aligned_cols=110 Identities=48% Similarity=0.779 Sum_probs=80.5
Q ss_pred CCeEEEEeCCCCCCCC--CccEEEEcccCCccEEEEeCCCCEEEee-cCCCCC-CccEEEEecCCCEEEecCCCCCCcce
Q 008733 91 EGTVTWVANRDAPLSD--RSGVLRINGERNGILVLLNSTNDTVWSS-NSSISA-QKPVAALMESGNLVVKDGKDNNPDNI 166 (555)
Q Consensus 91 ~~~~vW~anr~~p~~~--~~~~l~l~~~~dG~Lvl~~~~~~~~Wss-~~~~~~-~~~~~~L~d~GNlvl~~~~~~~~~~~ 166 (555)
++|+||+|||+.|+.. ...+|.|+. ||||+|++..++++|++ ++.+.. .++.|+|+|+|||||++.. +.+
T Consensus 1 ~~tvvW~an~~~p~~~~s~~~~L~l~~--dGnLvl~~~~~~~iWss~~t~~~~~~~~~~~L~~~GNlvl~d~~----~~~ 74 (114)
T PF01453_consen 1 PRTVVWVANRNSPLTSSSGNYTLILQS--DGNLVLYDSNGSVIWSSNNTSGRGNSGCYLVLQDDGNLVLYDSS----GNV 74 (114)
T ss_dssp ---------TTEEEEECETTEEEEEET--TSEEEEEETTTEEEEE--S-TTSS-SSEEEEEETTSEEEEEETT----SEE
T ss_pred CcccccccccccccccccccccceECC--CCeEEEEcCCCCEEEEecccCCccccCeEEEEeCCCCEEEEeec----ceE
Confidence 3689999999999953 238899999 99999999998899999 543222 4799999999999999964 899
Q ss_pred EEeecccCCCccCCCCccceecCCCCceEEEeccCCCCCC
Q 008733 167 LWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPA 206 (555)
Q Consensus 167 ~WqSFD~PTDTlLpgq~l~~~~~tg~~~~L~Sw~s~~dps 206 (555)
|||||||||||+||+|+|+.+..+|.+..|+||++.+|||
T Consensus 75 lW~Sf~~ptdt~L~~q~l~~~~~~~~~~~~~sw~s~~dps 114 (114)
T PF01453_consen 75 LWQSFDYPTDTLLPGQKLGDGNVTGKNDSLTSWSSNTDPS 114 (114)
T ss_dssp EEESTTSSS-EEEEEET--TSEEEEESTSSEEEESS----
T ss_pred EEeecCCCccEEEeccCcccCCCccccceEEeECCCCCCC
Confidence 9999999999999999999877777667799999999996
|
Each bulb-type lectin domain consists of three sequential beta-sheet subdomains (I, II, III) that are inter-related by pseudo three-fold symmetry. The three subdomains are flat four-stranded, antiparrallel beta-sheets. Together they form a 12-stranded beta-barrel in which the barrel axis coincides with the pseudo 3-fold axis.; GO: 0005529 sugar binding; PDB: 3M7H_A 3M7J_B 3MEZ_D 1DLP_A 1BWU_D 1KJ1_A 1B2P_A 1XD6_A 2DPF_C 2D04_B .... |
| >PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation | Back alignment and domain information |
|---|
| >cd00028 B_lectin Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >smart00108 B_lectin Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >PF08276 PAN_2: PAN-like domain; InterPro: IPR013227 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions [] | Back alignment and domain information |
|---|
| >cd01098 PAN_AP_plant Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins | Back alignment and domain information |
|---|
| >cd00129 PAN_APPLE PAN/APPLE-like domain; present in N-terminal (N) domains of plasminogen/ hepatocyte growth factor proteins, plasma prekallikrein/coagulation factor XI and microneme antigen proteins, plant receptor-like protein kinases, and various nematode and leech anti-platelet proteins | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00108 B_lectin Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >cd00028 B_lectin Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity | Back alignment and domain information |
|---|
| >smart00473 PAN_AP divergent subfamily of APPLE domains | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01100 APPLE_Factor_XI_like Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >PF00024 PAN_1: PAN domain This Prosite entry concerns apple domains, a subset of PAN domains; InterPro: IPR003014 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions [] | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >smart00223 APPLE APPLE domain | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14295 PAN_4: PAN domain; PDB: 2YIL_E 2YIP_C 2YIO_A | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 555 | |||
| 1kj1_A | 109 | Lectin I, lecgna 1; BULB lectin, mannose, plant pr | 3e-11 | |
| 3a0c_A | 110 | Mannose/sialic acid-binding lectin; beta-prism II, | 1e-10 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 4e-10 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 5e-09 | |
| 1xd5_A | 112 | Gastrodianin-1, antifungal protein GAFP-1; monocot | 5e-09 | |
| 2dpf_A | 115 | Curculin; sweet taste, taste modifying, plant prot | 8e-09 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 3e-08 | |
| 3dzw_A | 109 | Agglutinin; lectin, mannobiose, mannose-alpha1, 3- | 2e-07 | |
| 3r0e_A | 109 | Lectin; carbohydrate binding, carbohydrate, sugar | 1e-05 | |
| 3r0e_B | 110 | Lectin; carbohydrate binding, carbohydrate, sugar | 2e-05 | |
| 1b2p_A | 119 | Protein (lectin); mannose-binding lectin, monocot, | 4e-05 | |
| 3mez_B | 113 | Mannose-specific lectin 3 chain 2; heterotetramer, | 2e-04 | |
| 3m7h_A | 276 | Putidacin L1; monocot mannose-binding lectin, bact | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 |
| >1kj1_A Lectin I, lecgna 1; BULB lectin, mannose, plant protein; HET: MAN; 2.20A {Allium sativum} SCOP: b.78.1.1 PDB: 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Length = 109 | Back alignment and structure |
|---|
Score = 59.5 bits (144), Expect = 3e-11
Identities = 22/128 (17%), Positives = 47/128 (36%), Gaps = 21/128 (16%)
Query: 46 DTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLS 105
+ ++ G+ + G++L E + N + Y T W +N
Sbjct: 2 NLLTNGEGLYAGQSLDV--EPYHFIMQEDCNL------VLYDH---STSVWASNTGIL-- 48
Query: 106 DRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDN 165
+ + +G V+ ++ ++W+S+S V L E GN+V+ +
Sbjct: 49 -GKKGCKAVLQSDGNFVVYDAEGRSLWASHSVRGNGNYVLVLQEDGNVVIY-------GS 100
Query: 166 ILWQSFDY 173
+W + Y
Sbjct: 101 DIWSTGTY 108
|
| >3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Length = 110 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Length = 112 | Back alignment and structure |
|---|
| >2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Length = 115 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Length = 109 | Back alignment and structure |
|---|
| >3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 109 | Back alignment and structure |
|---|
| >3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 110 | Back alignment and structure |
|---|
| >1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Length = 119 | Back alignment and structure |
|---|
| >3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} Length = 113 | Back alignment and structure |
|---|
| >3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Length = 276 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 555 | |||
| 3m7h_A | 276 | Putidacin L1; monocot mannose-binding lectin, bact | 100.0 | |
| 1dlp_A | 236 | Lectin scafet precursor; two-domain lectin, beta p | 100.0 | |
| 4h3o_A | 105 | Lectin; cadmium, plant protein; 2.17A {Allium sati | 99.88 | |
| 3a0c_A | 110 | Mannose/sialic acid-binding lectin; beta-prism II, | 99.85 | |
| 1b2p_A | 119 | Protein (lectin); mannose-binding lectin, monocot, | 99.84 | |
| 2dpf_A | 115 | Curculin; sweet taste, taste modifying, plant prot | 99.82 | |
| 1xd5_A | 112 | Gastrodianin-1, antifungal protein GAFP-1; monocot | 99.81 | |
| 3dzw_A | 109 | Agglutinin; lectin, mannobiose, mannose-alpha1, 3- | 99.78 | |
| 3r0e_B | 110 | Lectin; carbohydrate binding, carbohydrate, sugar | 99.75 | |
| 3mez_B | 113 | Mannose-specific lectin 3 chain 2; heterotetramer, | 99.73 | |
| 3r0e_A | 109 | Lectin; carbohydrate binding, carbohydrate, sugar | 99.7 | |
| 1xd5_A | 112 | Gastrodianin-1, antifungal protein GAFP-1; monocot | 99.7 | |
| 3a0c_A | 110 | Mannose/sialic acid-binding lectin; beta-prism II, | 99.69 | |
| 1b2p_A | 119 | Protein (lectin); mannose-binding lectin, monocot, | 99.63 | |
| 2dpf_A | 115 | Curculin; sweet taste, taste modifying, plant prot | 99.62 | |
| 3mez_A | 111 | Mannose-specific lectin 3 chain 1; heterotetramer, | 99.59 | |
| 3mez_B | 113 | Mannose-specific lectin 3 chain 2; heterotetramer, | 99.44 | |
| 3mez_A | 111 | Mannose-specific lectin 3 chain 1; heterotetramer, | 99.38 | |
| 3dzw_A | 109 | Agglutinin; lectin, mannobiose, mannose-alpha1, 3- | 99.3 | |
| 3m7h_A | 276 | Putidacin L1; monocot mannose-binding lectin, bact | 99.3 | |
| 3r0e_B | 110 | Lectin; carbohydrate binding, carbohydrate, sugar | 99.28 | |
| 3r0e_A | 109 | Lectin; carbohydrate binding, carbohydrate, sugar | 99.24 | |
| 4h3o_A | 105 | Lectin; cadmium, plant protein; 2.17A {Allium sati | 99.17 | |
| 1dlp_A | 236 | Lectin scafet precursor; two-domain lectin, beta p | 99.02 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 97.44 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 97.11 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 97.08 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 96.56 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 96.48 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 96.38 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 95.99 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 95.52 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 95.16 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 94.95 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 94.9 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 94.89 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 94.78 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 94.75 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 94.66 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 94.61 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 94.34 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 94.34 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 93.98 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 93.87 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 93.6 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 93.57 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 93.3 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 93.25 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 93.24 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 92.91 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 92.85 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 92.77 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 92.77 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 92.6 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 92.51 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 92.33 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 92.24 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 92.17 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 92.16 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 91.97 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 91.92 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 91.84 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 91.83 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 91.79 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 91.77 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 91.77 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 91.71 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 91.71 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 91.69 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 91.63 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 91.6 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 91.47 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 91.46 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 91.36 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 91.22 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 91.21 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 91.2 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 91.19 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 91.16 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 91.15 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 91.07 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 90.92 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 90.87 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 90.87 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 90.82 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 90.74 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 90.73 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 90.61 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 90.5 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 90.5 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 90.48 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 90.47 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 90.45 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 90.44 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 90.43 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 90.43 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 90.37 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 90.35 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 90.29 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 90.27 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 90.22 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 90.21 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 90.08 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 90.08 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 90.07 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 90.06 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 90.03 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 90.02 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 89.98 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 89.95 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 89.9 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 89.82 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 89.71 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 89.69 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 89.68 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 89.68 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 89.68 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 89.58 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 89.56 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 89.51 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 89.4 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 89.39 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 88.86 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 88.85 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 88.85 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 88.83 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 88.77 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 88.7 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 88.62 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 88.56 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 88.56 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 88.45 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 88.38 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 88.34 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 88.33 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 88.31 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 88.13 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 87.91 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 87.87 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 87.85 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 87.63 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 87.49 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 86.5 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 86.26 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 86.1 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 86.1 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 86.05 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 86.01 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 85.93 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 85.55 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 85.32 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 85.15 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 84.91 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 84.42 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 84.4 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 83.08 | |
| 2ll3_A | 82 | Micronemal protein 4; cell adhesion; NMR {Toxoplas | 81.22 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 80.36 |
| >3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5e-43 Score=352.97 Aligned_cols=221 Identities=18% Similarity=0.214 Sum_probs=173.4
Q ss_pred hhccccccCCCCcccCCCeEEeCCCeEEEEEEcCCCCCceEEEEEEeecCCCeEEEEeCCCCCCCCC----ccEEEEccc
Q 008733 41 AARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDR----SGVLRINGE 116 (555)
Q Consensus 41 ~~~~~~~l~~g~~l~~~~~l~S~~g~F~lgF~~~~~~~~~~l~iw~~~~~~~~~vW~anr~~p~~~~----~~~l~l~~~ 116 (555)
++++.|+|.+|++|++|++|+|++|.|+||||+++ ++|| |+ +.+ +||+|||+.|+.+. +++|+|+.
T Consensus 10 ~~~~~~~l~~g~~l~~~~~l~S~~g~F~lgf~~~~---~~~l---y~--~~~-vvW~Anr~~p~~~~~~~~~~~l~l~~- 79 (276)
T 3m7h_A 10 NGVGTSVLPAYQTLSAGQYLLSPNQRFKLLLQGDG---NLVI---QD--NGA-TVWVANEQQPFSSTIPLRNKKAPLAF- 79 (276)
T ss_dssp CCTTSSEECTTEEBCTTCEEECTTSSEEEEECTTS---CEEE---EE--TTE-EEEECSTTSTTEEEEECCCTTCCSEE-
T ss_pred ccccCCEecCCCEecCCCEEEcCCCcEEEEEECCC---CeEE---EC--CCC-eEEECCCCCCcCCcccccceEEEEeC-
Confidence 35678999999999999999999999999999554 4676 65 666 99999999999864 68999999
Q ss_pred CCccEEE--EeCCCCEEEeecCCCC-----CCccEEEEecCCCEEEecCCCCCCcceEEeecccCCCccCCCCccceecC
Q 008733 117 RNGILVL--LNSTNDTVWSSNSSIS-----AQKPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLG 189 (555)
Q Consensus 117 ~dG~Lvl--~~~~~~~~Wss~~~~~-----~~~~~~~L~d~GNlvl~~~~~~~~~~~~WqSFD~PTDTlLpgq~l~~~~~ 189 (555)
||+||| .|+++.+||+++++.. ..++.|+|+|+|||||++ +.+|||| ||||||||||+|+.+.+
T Consensus 80 -~G~Lvl~~~~~~~~~vWst~~~~~~~~~~~~~~~a~L~d~GNlVl~~------~~~lWqS--~ptdtlLpg~~~~~~l~ 150 (276)
T 3m7h_A 80 -YVQYGAFLDDYSRRRVWLTDNSTFTSNDQWNRTHLVLQDDGNIVLVD------SLALWNG--TPAIPLVPGAIDSLLLA 150 (276)
T ss_dssp -EESSSEEEEEGGGTEEEEECCCCCCCTTHHHHEEEEECTTSCEEEEE------EEEEEES--CTTSCCCCSCTTCEEEC
T ss_pred -CCcEEEEEeCCCCCEEEEeCCCcccccccCCceEEEEeCCCCEEecC------CceeeCc--ccccccccccccccccc
Confidence 999999 7888899999997432 235789999999999997 5699999 99999999999998888
Q ss_pred CCCceEEEeccCCCCCCCcceEEEeCCCCCceEEEecC-CeeEEeeCCCCCcceecccccccCCeEEEEEEecCc-eEEE
Q 008733 190 TGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKN-SIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEK-EAFY 267 (555)
Q Consensus 190 tg~~~~L~Sw~s~~dps~G~f~l~l~~~g~~~l~~~~~-~~~yw~sg~w~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~ 267 (555)
+|.. | ++.+||++|.|+|+||++|+ ++++++ ..+||++++|+.... ...+.... .+.+.++++ .+..
T Consensus 151 ~g~~--L---~S~~dps~G~fsl~l~~dGn--lvLy~~~~~~yW~Sgt~~~~~~--~l~l~~dG--nLvl~d~~~~~vWs 219 (276)
T 3m7h_A 151 PGSE--L---VQGVVYGAGASKLVFQGDGN--LVAYGPNGAATWNAGTQGKGAV--RAVFQGDG--NLVVYGAGNAVLWH 219 (276)
T ss_dssp SSEE--E---CTTCEEEETTEEEEECTTSC--EEEECTTSSEEEECCCTTTTCC--EEEECTTS--CEEEECTTSCEEEE
T ss_pred cCcc--c---ccCCCCCCceEEEeecCCce--EEEEeCCCeEEEECCCCCCccE--EEEEcCCC--eEEEEeCCCcEEEE
Confidence 8754 6 57889999999999999996 455654 589999999975421 11222222 122333333 3333
Q ss_pred EEecCCCCceEEEEEccCCceEEEEe
Q 008733 268 TYNLSNSSVPSRMVINPAGTVQRYTW 293 (555)
Q Consensus 268 ~~~~~~~~~~~rl~Ld~dG~lr~y~~ 293 (555)
++ ......+|++|+.||+|++|.|
T Consensus 220 S~--t~~~~~~rl~Ld~dGnLvly~~ 243 (276)
T 3m7h_A 220 SH--TGGHASAVLRLQANGSIAILDE 243 (276)
T ss_dssp CS--CTTCTTCEEEECTTSCEEEEEE
T ss_pred ec--CCCCCCEEEEEcCCccEEEEcC
Confidence 22 2223357999999999999998
|
| >1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 | Back alignment and structure |
|---|
| >4h3o_A Lectin; cadmium, plant protein; 2.17A {Allium sativum} PDB: 1kj1_A* 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* | Back alignment and structure |
|---|
| >3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* | Back alignment and structure |
|---|
| >1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 | Back alignment and structure |
|---|
| >2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* | Back alignment and structure |
|---|
| >1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A | Back alignment and structure |
|---|
| >3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} SCOP: b.78.1.1 PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* | Back alignment and structure |
|---|
| >3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} | Back alignment and structure |
|---|
| >3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 | Back alignment and structure |
|---|
| >3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} | Back alignment and structure |
|---|
| >1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A | Back alignment and structure |
|---|
| >3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* | Back alignment and structure |
|---|
| >1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 | Back alignment and structure |
|---|
| >2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* | Back alignment and structure |
|---|
| >3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 | Back alignment and structure |
|---|
| >3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 | Back alignment and structure |
|---|
| >3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 | Back alignment and structure |
|---|
| >3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} SCOP: b.78.1.1 PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* | Back alignment and structure |
|---|
| >3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* | Back alignment and structure |
|---|
| >3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} | Back alignment and structure |
|---|
| >3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} | Back alignment and structure |
|---|
| >4h3o_A Lectin; cadmium, plant protein; 2.17A {Allium sativum} PDB: 1kj1_A* 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* | Back alignment and structure |
|---|
| >1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >2ll3_A Micronemal protein 4; cell adhesion; NMR {Toxoplasma gondii} PDB: 2ll4_M* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 555 | ||||
| d1kj1a_ | 109 | b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium | 3e-18 | |
| d1jpca_ | 108 | b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galan | 8e-14 | |
| d1dlpa2 | 120 | b.78.1.1 (A:116-235) Fetuin-binding protein Scafet | 2e-13 | |
| d1xd5a_ | 112 | b.78.1.1 (A:) Gastrodianin (antifungal protein) {G | 1e-12 | |
| d1b2pa_ | 119 | b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scill | 8e-10 | |
| d1dlpa1 | 115 | b.78.1.1 (A:1-115) Fetuin-binding protein Scafet p | 4e-08 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 0.001 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 0.003 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 0.003 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 0.004 |
| >d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Length = 109 | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Prism II superfamily: alpha-D-mannose-specific plant lectins family: alpha-D-mannose-specific plant lectins domain: Lectin (agglutinin) species: Garlic (Allium sativum) [TaxId: 4682]
Score = 78.1 bits (192), Expect = 3e-18
Identities = 20/128 (15%), Positives = 47/128 (36%), Gaps = 21/128 (16%)
Query: 46 DTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLS 105
+ ++ G+ + G++L + + L ++ T W +N
Sbjct: 2 NLLTNGEGLYAGQSLDV-------EPYHFIMQEDCNLVLYDH----STSVWASNTGILGK 50
Query: 106 DRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDN 165
+ + +G V+ ++ ++W+S+S V L E GN+V+ +
Sbjct: 51 KGCKAVLQS---DGNFVVYDAEGRSLWASHSVRGNGNYVLVLQEDGNVVIY-------GS 100
Query: 166 ILWQSFDY 173
+W + Y
Sbjct: 101 DIWSTGTY 108
|
| >d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Length = 108 | Back information, alignment and structure |
|---|
| >d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 120 | Back information, alignment and structure |
|---|
| >d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Length = 112 | Back information, alignment and structure |
|---|
| >d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 119 | Back information, alignment and structure |
|---|
| >d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 115 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 555 | |||
| d1xd5a_ | 112 | Gastrodianin (antifungal protein) {Gastrodia elata | 99.87 | |
| d1kj1a_ | 109 | Lectin (agglutinin) {Garlic (Allium sativum) [TaxI | 99.86 | |
| d1jpca_ | 108 | Lectin (agglutinin) {Snowdrop (Galanthus nivalis) | 99.85 | |
| d1dlpa2 | 120 | Fetuin-binding protein Scafet precursor {Bluebell | 99.71 | |
| d1b2pa_ | 119 | Lectin (agglutinin) {Bluebell (Scilla campanulata) | 99.68 | |
| d1dlpa1 | 115 | Fetuin-binding protein Scafet precursor {Bluebell | 99.63 | |
| d1dlpa1 | 115 | Fetuin-binding protein Scafet precursor {Bluebell | 99.52 | |
| d1dlpa2 | 120 | Fetuin-binding protein Scafet precursor {Bluebell | 99.34 | |
| d1b2pa_ | 119 | Lectin (agglutinin) {Bluebell (Scilla campanulata) | 99.29 | |
| d1jpca_ | 108 | Lectin (agglutinin) {Snowdrop (Galanthus nivalis) | 99.21 | |
| d1kj1a_ | 109 | Lectin (agglutinin) {Garlic (Allium sativum) [TaxI | 99.15 | |
| d1xd5a_ | 112 | Gastrodianin (antifungal protein) {Gastrodia elata | 99.03 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 96.57 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 95.68 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 94.95 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 94.88 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 94.31 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 94.25 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 94.21 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 93.87 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 93.85 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.33 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 90.23 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 88.29 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 87.12 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 85.83 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 85.47 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 84.88 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 84.53 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 84.3 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 82.02 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 81.31 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 80.37 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 80.02 |
| >d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Prism II superfamily: alpha-D-mannose-specific plant lectins family: alpha-D-mannose-specific plant lectins domain: Gastrodianin (antifungal protein) species: Gastrodia elata [TaxId: 91201]
Probab=99.87 E-value=3.6e-22 Score=171.82 Aligned_cols=112 Identities=20% Similarity=0.414 Sum_probs=95.5
Q ss_pred ccccCCCCcccCCCeEEeCCCeEEEEEEcCCCCCceEEEEEEeecCCCeEEEEeCCCCCCCCCccEEEEcccCCccEEEE
Q 008733 45 LDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLL 124 (555)
Q Consensus 45 ~~~l~~g~~l~~~~~l~S~~g~F~lgF~~~~~~~~~~l~iw~~~~~~~~~vW~anr~~p~~~~~~~l~l~~~~dG~Lvl~ 124 (555)
+|+|.+||.|.+|++|+| |.|+|.||.+|| |.+++ ..++||.||++.|.. .+.|.|+. ||+|+|+
T Consensus 1 tDtL~~gq~L~~g~~l~~--g~~~l~~q~DGN-----Lvly~----~~~~vW~s~~~~~~~--~~~l~l~~--dGnLvl~ 65 (112)
T d1xd5a_ 1 SDRLNSGHQLDTGGSLAE--GGYLFIIQNDCN-----LVLYD----NNRAVWASGTNGKAS--GCVLKMQN--DGNLVIY 65 (112)
T ss_dssp CCEEETTEEECTTCEEEE--TTEEEEECTTSC-----EEEEE----TTEEEEECCCTTSCS--SEEEEECT--TSCEEEE
T ss_pred CCEecCCCEecCCCEEEE--CCEEEEEcCCCC-----EEEEc----CCcEEEEccCccCCC--CcEEEEec--cccEEEE
Confidence 489999999999999975 999999999997 44443 478999999998754 37899999 9999999
Q ss_pred eCCCCEEEeecCCCCCCccEEEEecCCCEEEecCCCCCCcceEEeecccCCC
Q 008733 125 NSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCD 176 (555)
Q Consensus 125 ~~~~~~~Wss~~~~~~~~~~~~L~d~GNlvl~~~~~~~~~~~~WqSFD~PTD 176 (555)
++ +.++|++++....+..+|+|+|+||||||+.+ +.++|||+.||++
T Consensus 66 ~~-~~~~w~s~t~~~~~~~~l~L~ddGNlvly~~~----~~~~W~S~t~~~n 112 (112)
T d1xd5a_ 66 SG-SRAIWASNTNRQNGNYYLILQRDRNVVIYDNS----NNAIWATHTNVGN 112 (112)
T ss_dssp ET-TEEEEECCCCCSCCCCEEEECTTSCEEEECTT----SCEEEECCCCCCC
T ss_pred ec-CCeEEEEeeccCCCceEEEEcCCCCEEEECCC----CcEEecCCCccCC
Confidence 97 56888888655556678999999999999875 7899999999985
|
| >d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} | Back information, alignment and structure |
|---|
| >d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} | Back information, alignment and structure |
|---|
| >d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} | Back information, alignment and structure |
|---|
| >d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} | Back information, alignment and structure |
|---|
| >d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|