Citrus Sinensis ID: 008734


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-----
MLSTLHHPPRRLSRFFPANNKPRHFHTKPVLSSSQPVTDQSPSSTSPPESQILSIRHSLLSREVTATQLAETYLSRLKLAEPQLKSFIHVSNNVLKEAQSIDDKIKRNENVGPLAGVLVGVKDNICTVDMPSTAGSRVLENYRPPFDATAVKKVKEFDGIVVGKTNLDEFGMGSTTESSSFQVTANPWDISRVPGGSSGGSAAAVSARQCVVSLGSDTGGSVRQPASFCGVVGLKPTYGRVSRYGLIAYASSLDVIGCFGSSVADTGILLSAISGHDRLDATSSKQVRVLQISVSQEVPDFTSQLISAALLESKPLKGLKVGVIRETLENGVDSGVKSTVLGAVSHLEELGCTLSEVSLPSFSLGLPAYYILASSESSSNLSRYDGVRYGNQAAAEDLNALYGDSRAKGFGSEVKMRILMGTYALSAGYYDAYYKRAQQVRTLIQKSFKTALDENDILISPAAPSAAYKIGEKKNDPLAMYSGDIMTVNVNLAGLPALVLPCGFVEGGPIGLPVGLQMIGAAFDEGKLLKVGHIFEQTLQGCRFVPPLIADGIPQ
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHcccccccccccccEEEEEEECcccccccHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHcccccccccEEEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccccccccccccccccc
*************RFFPANNKPRHF************************SQILSIRHSLLSREVTATQLAETYLSRLKLAEPQLKSFIHVSNNVLKEAQSIDDKIKRNENVGPLAGVLVGVKDNICTVDMPSTAGSRVLENYRPPFDATAVKKVKEFDGIVVGKTNLDEFGMGSTTESSSFQVTANPWDISRVPGGSS*******SARQCVVSLGSDTGGSVRQPASFCGVVGLKPTYGRVSRYGLIAYASSLDVIGCFGSSVADTGILLSAISGHDRLDATSSKQVRVLQISVSQEVPDFTSQLISAALLESKPLKGLKVGVIRETLENGVDSGVKSTVLGAVSHLEELGCTLSEVSLPSFSLGLPAYYILASSESSSNLSRYDGVRYGNQAAAEDLNALYGDSRAKGFGSEVKMRILMGTYALSAGYYDAYYKRAQQVRTLIQKSFKTALDENDILISPAAPSAAYKIGEKKNDPLAMYSGDIMTVNVNLAGLPALVLPCGFVEGGPIGLPVGLQMIGAAFDEGKLLKVGHIFEQTLQGCRFVPPLI******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSTLHHPPRRLSRFFPANNKPRHFHTKPVLSSSQPVTDQSPSSTSPPESQILSIRHSLLSREVTATQLAETYLSRLKLAEPQLKSFIHVSNNVLKEAQSIDDKIKRNENVGPLAGVLVGVKDNICTVDMPSTAGSRVLENYRPPFDATAVKKVKEFDGIVVGKTNLDEFGMGSTTESSSFQVTANPWDISRVPGGSSGGSAAAVSARQCVVSLGSDTGGSVRQPASFCGVVGLKPTYGRVSRYGLIAYASSLDVIGCFGSSVADTGILLSAISGHDRLDATSSKQVRVLQISVSQEVPDFTSQLISAALLESKPLKGLKVGVIRETLENGVDSGVKSTVLGAVSHLEELGCTLSEVSLPSFSLGLPAYYILASSESSSNLSRYDGVRYGNQAAAEDLNALYGDSRAKGFGSEVKMRILMGTYALSAGYYDAYYKRAQQVRTLIQKSFKTALDENDILISPAAPSAAYKIGEKKNDPLAMYSGDIMTVNVNLAGLPALVLPCGFVEGGPIGLPVGLQMIGAAFDEGKLLKVGHIFEQTLQGCRFVPPLIADGIPQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).confidentE0CTY1
Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).confidentQ9LI77
Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).confidentQ7X8Z8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H0L, chain A
Confidence level:very confident
Coverage over the Query: 47-286,297-546
View the alignment between query and template
View the model in PyMOL