Citrus Sinensis ID: 008783


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550---
MCNPKPSSPSSFFSPRKPHYTNLNKTVDLHTDDPEELHRRPTPSEALEEMKAIGKISGPTAMTGLILYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLLLLSTSLPISFMWLNMKRILLWCGQDDEISSVAQTFILFAIPDLFFLSLLHPLRVYLRSQGITLPLTYCSAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFLLLSSFVYFSGVHKDSWVSPSMDCVRGWSSLLALAIPNCISVCLEWWWYELMIMICGLLINPKAAIASMGILIQITSLIYVFPSSLSLGVSTRVGNELGANRPSKARISMIVSLFCAVALGLMAVLFTTLMRHKWGRFFTNDAEILELTAIALPIIGLCELGNCPQTTGCGVLRGSARPKTGASINLGSFYLVGMPVAILMGFVAKMGFPGLWLGLLAAQASCALVMLHVLCRTDWMVQAERAKELTQTNATCLLILPVLSKPEDTIVTKQPNIKDINLEAILSINDDELVKSASLETDPLISTAAPSAT
ccccccccccccccccccccccccccccccccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHEEECcccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHEEHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHcccccHHHHccccccccccccccccccc
***************************************RPTPSEALEEMKAIGKISGPTAMTGLILYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLLLLSTSLPISFMWLNMKRILLWCGQDDEISSVAQTFILFAIPDLFFLSLLHPLRVYLRSQGITLPLTYCSAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFLLLSSFVYFSGVHKDSWVSPSMDCVRGWSSLLALAIPNCISVCLEWWWYELMIMICGLLINPKAAIASMGILIQITSLIYVFPSSLSLGVSTRVGNELGANRPSKARISMIVSLFCAVALGLMAVLFTTLMRHKWGRFFTNDAEILELTAIALPIIGLCELGNCPQTTGCGVLRGSARPKTGASINLGSFYLVGMPVAILMGFVAKMGFPGLWLGLLAAQASCALVMLHVLCRTDWMVQAERAKELTQT***************************IN*EA**SIN************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCNPKPSSPSSFFSPRKPHYTNLNKTVDLHTDDPEELHRRPTPSEALEEMKAIGKISGPTAMTGLILYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLLLLSTSLPISFMWLNMKRILLWCGQDDEISSVAQTFILFAIPDLFFLSLLHPLRVYLRSQGITLPLTYCSAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFLLLSSFVYFSGVHKDSWVSPSMDCVRGWSSLLALAIPNCISVCLEWWWYELMIMICGLLINPKAAIASMGILIQITSLIYVFPSSLSLGVSTRVGNELGANRPSKARISMIVSLFCAVALGLMAVLFTTLMRHKWGRFFTNDAEILELTAIALPIIGLCELGNCPQTTGCGVLRGSARPKTGASINLGSFYLVGMPVAILMGFVAKMGFPGLWLGLLAAQASCALVMLHVLCRTDWMVQAERAKELTQTNATCLLILPVLSKPEDTIVTKQPNIKDINLEAILSINDDELVKSASLETDPLISTAAPSAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Multidrug and toxin extrusion protein 1 Solute transporter for tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, N-methylnicotinamide (NMN), metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, ganciclovir and also the zwitterionic cephalosporin, cephalexin and cephradin. Seems to also play a role in the uptake of oxaliplatin (a new platinum anticancer agent). Able to transport paraquat (PQ or N,N-dimethyl-4-4'-bipiridinium); a widely used herbicid. Responsible for the secretion of cationic drugs across the brush border membranes.probableQ96FL8
Multidrug and toxin extrusion protein 1 Solute transporter for tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, N-methylnicotinamide (NMN), metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, ganciclovir and also the zwitterionic cephalosporin, cephalexin and cephradin. Seems to also play a role in the uptake of oxaliplatin (a new platinum anticancer agent). Able to transport paraquat (PQ or N,N-dimethyl-4-4'-bipiridinium); a widely used herbicid. Responsible for the secretion of cationic drugs across the brush border membranes.probableQ5RFD2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MKT, chain A
Confidence level:very confident
Coverage over the Query: 44-478
View the alignment between query and template
View the model in PyMOL